| Clone Name | bast64f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUN9_ARATH (Q9C9H5) Probable family 9 endoglucanase At1g71380 pr... | 30 | 2.8 | 2 | PROC_SHIFL (P0A9L9) Pyrroline-5-carboxylate reductase (EC 1.5.1.... | 30 | 3.6 | 3 | PROC_ECOLI (P0A9L8) Pyrroline-5-carboxylate reductase (EC 1.5.1.... | 30 | 3.6 |
|---|
>GUN9_ARATH (Q9C9H5) Probable family 9 endoglucanase At1g71380 precursor (EC| 3.2.1.4) Length = 484 Score = 30.0 bits (66), Expect = 2.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 373 KVLGGGKPADVFMWRNKHISAGVL 444 K LGGG D+F W NK+ A VL Sbjct: 257 KSLGGGDQPDIFSWDNKYAGAYVL 280
>PROC_SHIFL (P0A9L9) Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C| reductase) Length = 269 Score = 29.6 bits (65), Expect = 3.6 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = +1 Query: 337 MFRLFGR-----EQPIHKVLG--GGKPADVFMWRNKHISAGVLGG 450 +FR FG E IH V+G G PA VFM+ A VLGG Sbjct: 150 IFRCFGEAEVIAEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGG 194
>PROC_ECOLI (P0A9L8) Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C| reductase) Length = 269 Score = 29.6 bits (65), Expect = 3.6 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = +1 Query: 337 MFRLFGR-----EQPIHKVLG--GGKPADVFMWRNKHISAGVLGG 450 +FR FG E IH V+G G PA VFM+ A VLGG Sbjct: 150 IFRCFGEAEVIAEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGG 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,412,125 Number of Sequences: 219361 Number of extensions: 469462 Number of successful extensions: 1834 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1830 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)