| Clone Name | bast64e06 |
|---|---|
| Clone Library Name | barley_pub |
>TGM1_MOUSE (Q9JLF6) Protein-glutamine gamma-glutamyltransferase K (EC| 2.3.2.13) (Transglutaminase K) (TGase K) (TGK) (TG(K)) (Transglutaminase-1) (Epidermal TGase) Length = 815 Score = 31.6 bits (70), Expect = 0.91 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 396 PSGRTGRWRRKPWTPPRHPRP 334 P GRW R PW PP P P Sbjct: 4 PRSDVGRWGRSPWQPPTTPSP 24
>ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1906 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 441 CGAA*EAWAGETPSPPSGRTGRWRRKPWTP 352 C A E A P+ P GR +WR WTP Sbjct: 1130 CLAIPEVGATSLPAIPLGRAAQWRHGSWTP 1159
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 417 AGETPSPPSGRTGRWRRKPWTPPRHPRPA 331 +G+ P PPSG W+++ PP P P+ Sbjct: 486 SGQPPPPPSGPLPPWQQQQQQPPPPPPPS 514
>PPCK_CHLMU (Q9PLL6) Phosphoenolpyruvate carboxykinase [GTP] (EC 4.1.1.32) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 599 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 420 WAGETPSPPSGRTGRWRRKPWTPPRHP 340 W G+T +PP G W+ + WTP P Sbjct: 351 WEGKTATPPQGMID-WKGRNWTPGGEP 376
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 78 SFPSQYKTPFLPSSSIDRHTQPARNRHQQLLQETMRN 188 SFP Y T P++S+ + P R+ Q LLQ + R+ Sbjct: 198 SFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRD 234
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 417 AGETPSPPSGRTGRWRRKPWTPPRHPRPA 331 +G+ P PPSG W+++ PP P P+ Sbjct: 486 SGQPPPPPSGPLPPWQQQQQQPPPPPPPS 514
>KPRO_MAIZE (P17801) Putative receptor protein kinase ZmPK1 precursor (EC| 2.7.11.1) Length = 817 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -1 Query: 214 DSWGLLSMMFLMVSCRSCWCLLRAGCVCLSMEDDGRNGVLYCEGKLVS-RTHQTGQTR 44 D WG L VS R+C + + C C + G Y + L S RT+ T R Sbjct: 359 DFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVR 416
>TGM1_CANFA (Q9GLK0) Protein-glutamine gamma-glutamyltransferase K (EC| 2.3.2.13) (Transglutaminase K) (TGase K) (TGK) (TG(K)) (Transglutaminase-1) (Epidermal TGase) Length = 815 Score = 28.9 bits (63), Expect = 5.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 396 PSGRTGRWRRKPWTPPRHPRP 334 P GRW PW PP P P Sbjct: 4 PRSDVGRWGGNPWQPPTTPSP 24
>POLS_RUBVM (P08563) Structural polyprotein [Contains: Nucleocapsid protein C;| Membrane glycoprotein E2; Membrane glycoprotein E1] Length = 992 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = -2 Query: 411 ETPSPPSGRTGRWRRKPWT---PPRHPR 337 E P+PP RTG W+RK W+ PP R Sbjct: 58 EGPAPP--RTGAWQRKDWSRAPPPPEER 83
>SPEA_YERPE (Q8ZHG8) Biosynthetic arginine decarboxylase (EC 4.1.1.19) (ADC)| Length = 659 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 10 LTVTHTLLFSSLLSVQFGGFCSPVSPHSTKPHS 108 +T HT+L S+++ V+ FC P P + P + Sbjct: 366 VTAHHTVLVSNVIGVERNEFCEPQPPEAGAPRA 398 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,665,129 Number of Sequences: 219361 Number of extensions: 1158525 Number of successful extensions: 3874 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3872 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)