| Clone Name | bast64d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RT4I1_HUMAN (Q8WWV3) Reticulon-4-interacting protein 1, mitochon... | 30 | 1.2 | 2 | H11_CAEEL (P10771) Histone H1.1 | 30 | 1.2 | 3 | VGAM_BPMU (P06023) Host-nuclease inhibitor protein gam | 29 | 3.5 |
|---|
>RT4I1_HUMAN (Q8WWV3) Reticulon-4-interacting protein 1, mitochondrial precursor| (NOGO-interacting mitochondrial protein) Length = 396 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 193 RRSAMTAVVLWGQKATGAPDLRRLAGVAPLQATAEAMV 80 RR+A TAV W K P +RR++ +P A V Sbjct: 10 RRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWV 47
>H11_CAEEL (P10771) Histone H1.1| Length = 207 Score = 30.4 bits (67), Expect = 1.2 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 93 AVACKGATPASLLKSGAPVAFCPHNTTAVIADRRPYNTLVKEAIRYDDDHSGRD-LVIPS 269 A A K A P + K+ APVA PY ++KEAI+ D G I Sbjct: 17 AKAAKAAKPTKVAKAKAPVA------------HPPYINMIKEAIKQLKDRKGASKQAILK 64 Query: 270 FISQD 284 FISQ+ Sbjct: 65 FISQN 69
>VGAM_BPMU (P06023) Host-nuclease inhibitor protein gam| Length = 174 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 111 ATPASLLKSGAPVAFCPHNTTAVIADRRPYNTLVKEAIRYDDD 239 A PA +KS A A+ P N AVI D + L +EA R + + Sbjct: 2 AKPAKRIKSAA-AAYVPQNRDAVITDIKRIGDLQREASRLETE 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,500,307 Number of Sequences: 219361 Number of extensions: 236081 Number of successful extensions: 745 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)