| Clone Name | bast64c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KATAM_ARATH (Q7XJ98) Xyloglucan galactosyltransferase KATAMARI 1... | 70 | 4e-12 | 2 | ABI1_RAT (Q9QZM5) Abl interactor 1 (Abelson interactor 1) (Abi-1... | 29 | 5.9 | 3 | ABI1_HUMAN (Q8IZP0) Abl interactor 1 (Abelson interactor 1) (Abi... | 29 | 5.9 | 4 | ABI1_MOUSE (Q8CBW3) Abl interactor 1 (Abelson interactor 1) (Abi... | 29 | 7.7 |
|---|
>KATAM_ARATH (Q7XJ98) Xyloglucan galactosyltransferase KATAMARI 1 (EC 2.4.1.-)| (MURUS3 protein) Length = 619 Score = 69.7 bits (169), Expect = 4e-12 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 5/117 (4%) Frame = +1 Query: 133 DSSDPCAGRRIHIRDLPPRFNTHLLRHCDAAFPLADXXXXXXXXXXCESLANHGLGPSTH 312 + SDPC G+ I++ +LP +FN +LR C C+ N GLGP Sbjct: 146 NKSDPCGGKYIYVHNLPSKFNEDMLRDCKKL---------SLWTNMCKFTTNAGLGPPLE 196 Query: 313 A-----RSRSWYRTDARLLEPFFHRRLLERRCLVADPGLADAVFVPYYAALDSIPYV 468 WY T+ ++ F R+ + +CL D LA A+FVP+YA D Y+ Sbjct: 197 NVEGVFSDEGWYATNQFAVDVIFSNRMKQYKCLTNDSSLAAAIFVPFYAGFDIARYL 253
>ABI1_RAT (Q9QZM5) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Eps8 SH3| domain-binding protein) (Eps8-binding protein) (e3B1) Length = 475 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 26 SLSLARPTPP----TPRCPILXXXXXXXXXXAQSPETPPP 133 S+S+A P PP TP+ P+ A SP PPP Sbjct: 326 SISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPP 365
>ABI1_HUMAN (Q8IZP0) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin| SH3 domain-binding protein 1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) (Nap1-binding protein) (Nap1BP) (Abl-binding protein 4) (AblBP4) Length = 507 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 26 SLSLARPTPP----TPRCPILXXXXXXXXXXAQSPETPPP 133 S+S+A P PP TP+ P+ A SP PPP Sbjct: 358 SISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPP 397
>ABI1_MOUSE (Q8CBW3) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin| SH3 domain-binding protein 1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) (Ablphilin-1) Length = 480 Score = 28.9 bits (63), Expect = 7.7 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 26 SLSLARPTPP----TPRCPILXXXXXXXXXXAQSPETPPP 133 S+S+A P PP TP+ P+ A SP PPP Sbjct: 331 SISVAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPP 370 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,500,386 Number of Sequences: 219361 Number of extensions: 686937 Number of successful extensions: 2773 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2767 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)