| Clone Name | bast64c02 |
|---|---|
| Clone Library Name | barley_pub |
>FIBA_RAT (P06399) Fibrinogen alpha chain precursor [Contains: Fibrinopeptide| A] Length = 782 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 117 GGSGSGWWRPGCVRACARGDSGLVDSGVEADLRIWGWG 4 G GSG+WRPG + + G+ G +G + D WG G Sbjct: 299 GHGGSGYWRPGSSGSGSDGNWGSGTTGSD-DTGTWGAG 335
>YMD8_YEAST (Q03697) Hypothetical 49.6 kDa protein in CAT2-AMD1 intergenic| region Length = 442 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 233 YVAVWIFLSFAVIVYNKYILDPK 301 +V W F S A+ +YN+++ DPK Sbjct: 9 FVFGWYFCSIALSIYNRWMFDPK 31
>SMS1_CHICK (Q7T3T4) Phosphatidylcholine:ceramide cholinephosphotransferase 1| (EC 2.7.-.-) (Sphingomyelin synthase 1) (MOB protein) Length = 417 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 194 SESVMRKVLLSYCYVAVWIFLSFAVIVYNKYILDPKMYNWPFP 322 ++ V+++ + VW + F N + P+ Y+WPFP Sbjct: 356 NQQVLKEASQTNLLARVWWYKPFQYFEKNVQGIVPRSYHWPFP 398
>SMS1_MOUSE (Q8VCQ6) Phosphatidylcholine:ceramide cholinephosphotransferase 1| (EC 2.7.-.-) (Transmembrane protein 23) (Sphingomyelin synthase 1) (Mob protein) Length = 419 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +2 Query: 194 SESVMRKVLLSYCYVAVWIFLSFAVIVYNKYILDPKMYNWPFP 322 ++ V+++ VW + F N + P+ Y+WPFP Sbjct: 358 NQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFP 400
>SMS1_HUMAN (Q86VZ5) Phosphatidylcholine:ceramide cholinephosphotransferase 1| (EC 2.7.-.-) (Transmembrane protein 23) (Sphingomyelin synthase 1) (Mob protein) Length = 419 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +2 Query: 194 SESVMRKVLLSYCYVAVWIFLSFAVIVYNKYILDPKMYNWPFP 322 ++ V+++ VW + F N + P+ Y+WPFP Sbjct: 358 NQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFP 400
>SWF1_YEAST (Q04629) Palmitoyltransferase SWF1 (EC 2.3.1.-) (Spore wall| formation protein 1) Length = 336 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 215 VLLSYCYVAVWIFLSFAVIVYNKYILDPKMYNW 313 +LLS + + W F +F V+ +++D + Y W Sbjct: 17 ILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRW 49
>TIE1_MOUSE (Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC| 2.7.10.1) Length = 1134 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 114 GSGSGWWRPGCVRAC 70 G G+G W PGCV+ C Sbjct: 212 GCGAGRWGPGCVKDC 226 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,750,100 Number of Sequences: 219361 Number of extensions: 221168 Number of successful extensions: 555 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)