| Clone Name | bast64a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MBB1A_HUMAN (Q9BQG0) Myb-binding protein 1A | 28 | 8.1 |
|---|
>MBB1A_HUMAN (Q9BQG0) Myb-binding protein 1A| Length = 1328 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 170 SSLQQLASKKRKDHGYLPSLAWYCTKEKKRQRTRKG 63 S+ Q SKKRK G+LP TK++K++++ G Sbjct: 1159 SATQSPISKKRKKKGFLPE-----TKKRKKRKSEDG 1189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,046,019 Number of Sequences: 219361 Number of extensions: 341710 Number of successful extensions: 746 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)