| Clone Name | bast63h07 |
|---|---|
| Clone Library Name | barley_pub |
>NPBL_COPCI (Q00333) Protein rad9 (SCC2 homolog)| Length = 2157 Score = 34.3 bits (77), Expect = 0.073 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -3 Query: 257 SWSSMTR-SEPMTPPSIADDGCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYGK 90 S+ MT S+P+TP R APL+ + R + AS +P A++S S+ S+ S K Sbjct: 372 SYKPMTLISQPLTPS-------RGAPLTPTSRASNASSVPTTASSSTSITSMSSSSK 421
>TWIST_DROME (P10627) Protein twist| Length = 490 Score = 32.0 bits (71), Expect = 0.36 Identities = 19/50 (38%), Positives = 23/50 (46%) Frame = -3 Query: 302 SGTRPDIEKTMMKATSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATA 153 S R D+E A S S M+P +ADDG + L GSD G A Sbjct: 290 SSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKA 339
>TWIST_DROER (Q8I1G0) Protein twist| Length = 490 Score = 32.0 bits (71), Expect = 0.36 Identities = 19/50 (38%), Positives = 23/50 (46%) Frame = -3 Query: 302 SGTRPDIEKTMMKATSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATA 153 S R D+E A S S M+P +ADDG + L GSD G A Sbjct: 290 SSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKA 339
>BRNQ_BACSU (P94499) Branched-chain amino acid transport system carrier protein| brnQ (Branched-chain amino acid uptake carrier brnQ) Length = 440 Score = 30.8 bits (68), Expect = 0.81 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +1 Query: 232 SLRVIELQLVAFIMVFSMSGLVPLIDLAFPVVTTLYLIVLSRLAFPSLHS 381 S + I + L F + + GL LI ++ PV+ T+Y I +S + LHS Sbjct: 317 SYKKIAVVLSVFSTLVANIGLTQLIKVSMPVLLTMYPIAISLIFLTFLHS 366
>ASX_DROME (Q9V727) Polycomb protein Asx (Additional sex combs)| Length = 1669 Score = 30.8 bits (68), Expect = 0.81 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = -3 Query: 314 ARSMSGTRPDIEKTMMKATSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATASDIPDM 135 A S+SG+ P T TS SS + S + S +AP + S GA + + Sbjct: 667 ASSISGSTPASSITSTSCTSSSSSSASMSSSCSSSNSGSTTTAPTTSSSAGAPTAPLTLA 726 Query: 134 AAASVSLLSI 105 AAA +L ++ Sbjct: 727 AAAETTLANV 736
>SYTL5_RAT (Q812E4) Synaptotagmin-like protein 5| Length = 753 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 182 LSGSDRGAT-ASDIPDMAAASVSLLSICSYGKCATDRRSP 66 +SGSDRG+T +SD+ D A + CS G +RSP Sbjct: 225 VSGSDRGSTTSSDLTDQEAGRGAPKGSCSNGGIPVTQRSP 264
>KN8R_YEAST (P53739) Probable serine/threonine-protein kinase YNR047W (EC| 2.7.11.1) Length = 893 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 287 DIEK-TMMKATSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATASD 147 D++K K WS + EP P +++DG A LS + + T+ D Sbjct: 770 DVKKHPFFKKVQWSLLRNQEPPLIPVLSEDGYDFAKLSSNKKRQTSQD 817
>IAA19_ARATH (O24409) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) (MASSUGU2 protein) Length = 197 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/66 (27%), Positives = 27/66 (40%) Frame = -3 Query: 287 DIEKTMMKATSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATASDIPDMAAASVSLLS 108 D+ + MMK +++ M MT D C S +S +D P + V Sbjct: 21 DVAEKMMKKRAFTEMN----MTSSGSNSDQCESGVVSSGGDAEKVNDSPAAKSQVVGWPP 76 Query: 107 ICSYGK 90 +CSY K Sbjct: 77 VCSYRK 82
>EGSA_PYRFU (Q8U147) Glycerol-1-phosphate dehydrogenase [NAD(P)] (EC 1.1.1.261)| (sn-glycerol-1-phosphate dehydrogenase) (G-1-P dehydrogenase) (Enantiomeric glycerophosphate synthase) Length = 346 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/65 (30%), Positives = 32/65 (49%) Frame = +1 Query: 19 LSSRKLVPRCSSFHYSGDRRSVAHLP*LQIDRRLTEAAAMSGISLAVAPRSDPDNGAERQ 198 L S K+V R + GD V R++ +A SG+++++A S P +GAE Sbjct: 198 LMSAKMVMRDAEIIRIGDDEGV---------RKVVKALISSGVAMSIAGSSRPASGAEHL 248 Query: 199 PSSAM 213 S A+ Sbjct: 249 FSHAL 253
>POLG_HCVCO (Q9WMX2) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 200 GCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYGKCAT 81 GC L+G DR ++ ++ A+ S L+ C G C T Sbjct: 1040 GCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWT 1079
>PAC1_PSES3 (P15557) Acylase ACY 1 [Includes: Cephalosporin acylase (EC| 3.5.1.-) (GL-7ACA acylase); Gamma-glutamyltranspeptidase (EC 2.3.2.2) (GGT)] [Contains: Acylase ACY 1 large subunit; Acylase ACY 1 small subunit] Length = 557 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 230 PMTPPSIADDGCRSAPLSGSDRGATASDIPDMAAASVSLL 111 P+ P +AD C P SGS RG ++ P +AA +L Sbjct: 3 PVPVPRVADFTCEKKPASGS-RGMVVTNHPLASAAGAQIL 41
>E78C_DROME (P45447) Ecdysone-induced protein 78C (DR-78)| Length = 866 Score = 27.7 bits (60), Expect = 6.9 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = -3 Query: 260 TSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATASDIPDMAAASVSLLS 108 TS SS + S + P D GC SA SGS R +S ++A S +S Sbjct: 239 TSSSSPSSSAAHSSP---DSGCSSASSSGSSRSCGSSSASSSSSAVSSTIS 286
>SNPC3_MACFA (Q4R6Y6) snRNA-activating protein complex subunit 3 (SNAPc subunit| 3) (snRNA-activating protein complex 50 kDa subunit) (SNAPc 50 kDa subunit) (Small nuclear RNA-activating complex polypeptide 3) Length = 412 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -3 Query: 221 PPSIADDGCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYG--KCATDRRSPE 63 PP+ A G R S + A A D+ A+ L ++C KC D PE Sbjct: 66 PPASALPGSRGIADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPE 120
>POLG_HCVTW (P29846) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 200 GCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYGKCAT 81 GC L+G D+ ++ ++ A+ S L+ C G C T Sbjct: 1040 GCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWT 1079
>POLG_HCVJT (Q00269) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 200 GCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYGKCAT 81 GC L+G D+ ++ ++ A+ S L+ C G C T Sbjct: 1040 GCIVTSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWT 1079
>POLG_HCVJA (P26662) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 200 GCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYGKCAT 81 GC L+G D+ ++ ++ A+ S L+ C G C T Sbjct: 1040 GCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWT 1079
>POLG_HCVBK (P26663) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 200 GCRSAPLSGSDRGATASDIPDMAAASVSLLSICSYGKCAT 81 GC L+G D+ ++ ++ A+ S L+ C G C T Sbjct: 1040 GCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWT 1079
>MOX2R_RAT (Q9ES58) Cell surface glycoprotein OX2 receptor precursor (CD200| cell surface glycoprotein receptor) (OX102 antigen) Length = 327 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = -3 Query: 290 PDIEKTMMKATSWSSMTRSEPMTPPSIADDGCRSAPLSGSDRGATASDIPDMAA-ASVSL 114 P I T + +W+ R +P S D + + SDR T + PD+A +S Sbjct: 59 PSISLTKVILITWTITLRGQPSCIISYKADTRETHESNCSDRSITWASTPDLAPDLQISA 118 Query: 113 LSICSYGKCATDRRSPE 63 +++ G+ + D P+ Sbjct: 119 VALQHEGRYSCDIAVPD 135
>MMSB_PSEAE (P28811) 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (HIBADH)| Length = 298 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 112 RRLTEAAAMSGISLAVAPRSDPDNGAERQPSSAMLGG 222 R++ EAAA G++L AP S GA S ++GG Sbjct: 103 RKVAEAAAAKGLTLLDAPVSGGVGGARAGTLSFIVGG 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,919,194 Number of Sequences: 219361 Number of extensions: 559741 Number of successful extensions: 1924 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1923 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)