| Clone Name | bast63g08 |
|---|---|
| Clone Library Name | barley_pub |
>FLHF_TREPA (Q56339) Flagellar biosynthesis protein flhF (Flagella-associated| GTP-binding protein) Length = 437 Score = 33.1 bits (74), Expect = 0.26 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 298 FERVDAAMEEWIVERMHTLRPVIETGYENLLLV 396 FE+V++ + WI+E +H P I TG N++LV Sbjct: 191 FEKVESTVLRWIIESVHIQVPPICTGTRNIVLV 223
>VILI4_ARATH (O65570) Villin-4| Length = 974 Score = 30.0 bits (66), Expect = 2.2 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -3 Query: 91 PRPVKAPPSSPGRQAPEPDARREELRR 11 P+PVKA P +P APE +++ +E ++ Sbjct: 854 PKPVKASPKTPESPAPESNSKEQEEKK 880
>PEXLP_TOBAC (Q03211) Pistil-specific extensin-like protein precursor (PELP)| Length = 426 Score = 24.6 bits (52), Expect(2) = 3.0 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = -3 Query: 91 PRPVKAPPSSPGRQ------APEPDARREELRRP 8 P PVKAP SP Q P P A++ L P Sbjct: 201 PPPVKAPSPSPATQPPTKQPPPPPRAKKSPLLPP 234 Score = 23.5 bits (49), Expect(2) = 3.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 248 PPQLSQKTPSKSRANRSPPP 189 PP K PS S A + PPP Sbjct: 181 PPPPPVKAPSPSPAKQPPPP 200
>DYN3_HUMAN (Q9UQ16) Dynamin-3 (EC 3.6.5.5) (Dynamin, testicular) (T-dynamin)| Length = 859 Score = 29.3 bits (64), Expect = 3.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -3 Query: 88 RPVKAPPSSPGRQAPEPDARREELRRPL 5 RP +APPS P R+ P P R + RPL Sbjct: 827 RPTRAPPSVPSRR-PPPSPTRPTIIRPL 853
>ACINU_MOUSE (Q9JIX8) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1338 Score = 28.9 bits (63), Expect = 4.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 91 PRPVKAPPSSPGRQAPEPDARREELRRPLR 2 PRP+ PP P + P P A + E R +R Sbjct: 1113 PRPLHPPPPPPVQPPPHPRAEQREQERAVR 1142
>PHAR2_HUMAN (O75167) Phosphatase and actin regulator 2| Length = 634 Score = 23.9 bits (50), Expect(2) = 6.2 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -2 Query: 317 AASTRSNTQGHXXXXXXXAERELPPQLSQKTPSKSRANRSPPP 189 A + NT+ H A LPP K SK + +SP P Sbjct: 136 AEDKKENTENHSETPAAPA---LPPSAPPKPRSKPKPKKSPVP 175 Score = 23.1 bits (48), Expect(2) = 6.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 85 PVKAPPSSPGRQAPEP 38 P+K +PG+QAP P Sbjct: 192 PIKKNTKAPGKQAPVP 207
>CDC12_SCHPO (Q10059) Cell division control protein 12| Length = 1841 Score = 28.1 bits (61), Expect = 8.3 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = +1 Query: 244 GGSSLSAVKAAKV--RWPWVFERVDAAMEEWIVERMHTLRP--VIETGYENLL 390 GG +++ K A RW +++ R+ + + +RM+ L+ +IET YENL+ Sbjct: 1119 GGDLVNSEKDASELSRWDYLYVRLIVDLGGYWNQRMNALKVKNIIETNYENLV 1171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,038,049 Number of Sequences: 219361 Number of extensions: 465315 Number of successful extensions: 2933 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2925 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)