| Clone Name | bast63g06 |
|---|---|
| Clone Library Name | barley_pub |
>YC66L_SYNY3 (Q55823) Ycf66-like protein| Length = 337 Score = 33.5 bits (75), Expect = 0.29 Identities = 24/81 (29%), Positives = 33/81 (40%), Gaps = 7/81 (8%) Frame = +2 Query: 242 TPAGEDVLDPSATPLRRRGARIRAYAHGRRHLRPE-------LVRYCALLRHRPPSVQQP 400 T A D L+P P+ R R+R Y R RP+ R + R+ PP+ P Sbjct: 111 TEAELDQLEPEDEPVARNNRRLRGYDDDARSGRPDGYGEAEARPRPRSQGRNAPPTNPNP 170 Query: 401 KPLQRSPRARARIHPSPAHAP 463 +P + P A P AP Sbjct: 171 RPTRSRPSAGRSAPQRPGPAP 191
>MA2B1_CAVPO (Q8VHC8) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24)| (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1) Length = 1007 Score = 32.0 bits (71), Expect = 0.83 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +3 Query: 357 TAPSSDIGLPQSNNPNLFSDLLGPALGSTRAQPTRRSDQ 473 T PS+ + L S NP L L PALG + TR SDQ Sbjct: 542 TVPSTVVELTSSGNPELLFPALVPALGFSVYSVTRVSDQ 580
>POLN_MAYAB (Q8QZ73) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2436 Score = 30.0 bits (66), Expect = 3.2 Identities = 23/74 (31%), Positives = 30/74 (40%) Frame = +2 Query: 233 HMVTPAGEDVLDPSATPLRRRGARIRAYAHGRRHLRPELVRYCALLRHRPPSVQQPKPLQ 412 H TP E P P R R+ A R ++ E+ H+PPS Q KP+ Sbjct: 1710 HQPTPTAELATHPVPPPRPNRARRLAA---ARVQVQVEV--------HQPPSNQPTKPI- 1757 Query: 413 RSPRARARIHPSPA 454 P R + P PA Sbjct: 1758 --PAPRTSLRPVPA 1769
>BRD4_MOUSE (Q9ESU6) Bromodomain-containing protein 4 (Mitotic| chromosome-associated protein) (MCAP) Length = 1400 Score = 29.6 bits (65), Expect = 4.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 374 HRPPSVQQPKPLQRSPRARARIHPSPAH 457 H PP Q P P P+ + HPSP H Sbjct: 1024 HPPPGQQPPPPQPAKPQQVIQHHPSPRH 1051
>NETR_PONPY (Q5G269) Neurotrypsin precursor (EC 3.4.21.-)| Length = 877 Score = 29.6 bits (65), Expect = 4.1 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +2 Query: 314 YAHGRRHLRPELVRYCALL--RHRPPSVQQPKPLQRSPRARARIHPSPAHA 460 + H RH P ++Y L + RPP + P PL R PR + HA Sbjct: 31 HRHRHRHSPPPGLQYPYYLPTQQRPPRTRPPPPLPRFPRPPRALPAQRPHA 81
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.6 bits (65), Expect = 4.1 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = +2 Query: 290 RRGARIRAYAHGRRHLRPELVRYCALLRHRPPSVQQPKPLQRSPRARARIHPSPAHAPLR 469 R +R R+ + H RP R+ + R RP ++P P +R+P R+ P P H R Sbjct: 282 RSKSRSRSRSRSPSHSRPRR-RHRSRSRRRPSPRRRPSPRRRTP--PRRMPPPPRHRRSR 338 Query: 470 S 472 S Sbjct: 339 S 339
>VIME_RAT (P31000) Vimentin| Length = 465 Score = 29.3 bits (64), Expect = 5.4 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = +3 Query: 72 YSGDRSSSRPT------TTSFDSYQFDFGANASRSSTSRPLRDQRPGGA 200 + G +SSRP+ TTS +Y +A R STSR L PGGA Sbjct: 14 FGGSGTSSRPSSNRSYVTTSTRTYSL---GSALRPSTSRSLYSSSPGGA 59
>VIME_MOUSE (P20152) Vimentin| Length = 465 Score = 29.3 bits (64), Expect = 5.4 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = +3 Query: 72 YSGDRSSSRPT------TTSFDSYQFDFGANASRSSTSRPLRDQRPGGA 200 + G +SSRP+ TTS +Y +A R STSR L PGGA Sbjct: 14 FGGSGTSSRPSSNRSYVTTSTRTYSL---GSALRPSTSRSLYSSSPGGA 59
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 29.3 bits (64), Expect = 5.4 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +2 Query: 317 AHGRRHLRPELVRYC---ALLRHRPPSVQQPKPLQRSPRARARIHPSPAHAPLR 469 A+GR H P + Y L +PP QQP P Q+ P+ P P +P R Sbjct: 148 AYGRYHADPNMDPYRYGQPLPGGKPPQQQQPHPQQQPPQ-----QPGPGGSPNR 196
>RPGR1_MOUSE (Q9EPQ2) X-linked retinitis pigmentosa GTPase regulator-interacting| protein 1 (RPGR-interacting protein 1) Length = 1331 Score = 29.3 bits (64), Expect = 5.4 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +2 Query: 230 KHMVTPAGED--VLDPSATPLRR--RGARIRAYAHGRRHLRPELVRYCALLRHRPPSVQQ 397 +H++ ED V D ++PL + G +RA H R + EL L P V++ Sbjct: 2 QHLLEYMPEDLPVRDTDSSPLLKGTSGKNVRAQPHLGRMNQKELNCRRLHLHEEPTLVKE 61 Query: 398 PKPLQRSPRARAR 436 P P QR R R Sbjct: 62 PSPKQRDKNRRRR 74
>ZBT17_MOUSE (Q60821) Zinc finger and BTB domain-containing protein 17 (Zinc| finger protein 151) (Zinc finger protein 100) (Zfp-100) (Polyomavirus late initiator promoter-binding protein) (LP-1) (Zinc finger protein Z13) Length = 794 Score = 29.3 bits (64), Expect = 5.4 Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = -3 Query: 460 RVGWARVDPSAGPRRSLK--RFGLLD*GRPMSEEGAVADQLRPEMSPTMGIGPDP--SAA 293 R+G AR S GP R LK R G + +E+ AD P P + + PDP S A Sbjct: 149 RLGQARGSSSTGPGRELKEERGGQAESASSGAEQTEKAD--APREPPPVELKPDPTSSMA 206 Query: 292 AAE 284 AAE Sbjct: 207 AAE 209
>NETR_HUMAN (P56730) Neurotrypsin precursor (EC 3.4.21.-) (Motopsin) (Leydin)| Length = 875 Score = 29.3 bits (64), Expect = 5.4 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +2 Query: 320 HGRRHLRPELVRYCALL--RHRPPSVQQPKPLQRSPRARARIHPSPAHA 460 H RH P Y L + RPP+ + P PL R PR + HA Sbjct: 31 HSHRHSPPAGPHYPYYLPTQQRPPTTRPPPPLPRFPRPPRALPAQRPHA 79
>CREA_BOTCI (O94130) DNA-binding protein creA (Carbon catabolite repressor)| Length = 435 Score = 29.3 bits (64), Expect = 5.4 Identities = 24/90 (26%), Positives = 34/90 (37%), Gaps = 5/90 (5%) Frame = +2 Query: 212 TEANHHKHMVTPAGEDVLDPSATPLRRRGARIRAYAHGRRHLRPELVRYCALLRHRPPSV 391 T A H+ P + S+ R ++AYA R H E Y HR Sbjct: 230 TTATHYSQHTQPRHQPYYSHSSHNSRNHLPSLQAYAMTRAHSHEEDDHYA----HRHAKR 285 Query: 392 QQP-KPLQRSPRARARIH----PSPAHAPL 466 +P P+ +P + H P+P H PL Sbjct: 286 SRPNSPMSTAPSSPTFSHDSLSPTPDHTPL 315
>SCAR3_ARATH (Q9LP46) Protein SCAR3 (AtSCAR3) (Protein WAVE2)| Length = 1020 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 69 SYSGDRSSSRPTTTSFDSYQFDFGANASRSSTSR 170 S+SG SS++ T+TS ++DF + SRS SR Sbjct: 215 SFSGQTSSTKTTSTSDMEKRYDFQDHHSRSFESR 248
>M4K4_MOUSE (P97820) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1233 Score = 28.5 bits (62), Expect = 9.2 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = +2 Query: 335 LRPELVRYCALLRH---RPPSVQQPKPLQRSPRARARIH---PSPAHAP 463 L+ +L++ A+L H RP + QQP P Q+ R++ H P P + P Sbjct: 481 LQQQLLQEQAMLLHDHRRPHAQQQPPPPQQQDRSKPSFHAPEPKPHYDP 529
>NETR_PANTR (Q5G271) Neurotrypsin precursor (EC 3.4.21.-)| Length = 875 Score = 28.5 bits (62), Expect = 9.2 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +2 Query: 320 HGRRHLRPELVRYCALL--RHRPPSVQQPKPLQRSPRARARIHPSPAHA 460 H RH P Y L + RPP + P PL R PR + HA Sbjct: 31 HSHRHSPPPGPHYPYYLPTQQRPPRTRPPPPLPRFPRPPRALPAQRPHA 79
>NETR_MACMU (Q5G267) Neurotrypsin precursor (EC 3.4.21.-)| Length = 875 Score = 28.5 bits (62), Expect = 9.2 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +2 Query: 311 AYAHGRRHLRPELVRYCALL--RHRPPSVQQPKPLQRSPRARARIHPSPAHA 460 ++ H RH P +Y L RPP + P PL R PR + HA Sbjct: 28 SFHHRHRHSPPPGPQYPYYLPTHQRPPRTRPPPPLPRFPRPPRALPAQRPHA 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,110,375 Number of Sequences: 219361 Number of extensions: 894085 Number of successful extensions: 3853 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 3590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3840 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)