| Clone Name | bast63f11 |
|---|---|
| Clone Library Name | barley_pub |
>EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule-specific| protein homolog) (Latex allergen Hev b 13) Length = 391 Score = 69.3 bits (168), Expect = 2e-12 Identities = 35/69 (50%), Positives = 45/69 (65%) Frame = +2 Query: 185 FDRIFSFGDSLTDTGNFLLSVPDDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAEAF 364 F IF+FGDS +DTG + P PYG+TFF R +GRYSDGR ++DF AE+F Sbjct: 32 FPAIFNFGDSNSDTGGKAAAFYPLNP------PYGETFFHRSTGRYSDGRLIIDFIAESF 85 Query: 365 RLPFVPPYL 391 LP++ PYL Sbjct: 86 NLPYLSPYL 94
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 61.2 bits (147), Expect = 6e-10 Identities = 30/69 (43%), Positives = 42/69 (60%) Frame = +2 Query: 185 FDRIFSFGDSLTDTGNFLLSVPDDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAEAF 364 F IF+FGDS +DTG + P P+G +FFG P+GRY DGR ++DF AE+ Sbjct: 28 FPAIFNFGDSNSDTGGLSAAFGQAGP------PHGSSFFGSPAGRYCDGRLVIDFIAESL 81 Query: 365 RLPFVPPYL 391 LP++ +L Sbjct: 82 GLPYLSAFL 90
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 34.3 bits (77), Expect = 0.072 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = +2 Query: 194 IFSFGDSLTDTGNFLLSVPDDFPDPARSLPYGQTF-FGRPSGRYSDGRNLLDFFAEAFRL 370 +F FGDS+ DTGN + D PYG F G +GR+S+GR D+ ++ + Sbjct: 126 VFFFGDSIFDTGN---NNNLDTKLKCNYRPYGMDFPMGVATGRFSNGRVASDYISKYLGV 182 Query: 371 -PFVPPYL 391 VP Y+ Sbjct: 183 KEIVPAYV 190
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 32.7 bits (73), Expect = 0.21 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Frame = +2 Query: 194 IFSFGDSLTDTGNFLLSVPDDFPDPARS--LPYGQTF-FGRPSGRYSDGRNLLDFFAEAF 364 +F FGDS+ DTGN ++ +S PYG F F +GR+S+G D+ A+ Sbjct: 205 VFFFGDSVFDTGN-----NNNLETKIKSNYRPYGMDFKFRVATGRFSNGMVASDYLAKYM 259 Query: 365 RL-PFVPPYL 391 + VP YL Sbjct: 260 GVKEIVPAYL 269
>HLT_VIBPA (Q99289) Thermolabile hemolysin precursor (TL) (Lecithin-dependent| haemolysin) (LDH) (Atypical phospholipase) (Phospholipase A2) (Lysophospholipase) Length = 418 Score = 32.0 bits (71), Expect = 0.36 Identities = 21/70 (30%), Positives = 36/70 (51%) Frame = +2 Query: 188 DRIFSFGDSLTDTGNFLLSVPDDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAEAFR 367 +++ + GDSL+DTGN + FP+P ++F G +S+G ++ A+A Sbjct: 145 NKVVALGDSLSDTGNIFNASQWRFPNP-------NSWF---LGHFSNGFVWTEYIAKAKN 194 Query: 368 LPFVPPYLGG 397 LP +GG Sbjct: 195 LPLYNWAVGG 204
>TBX6_HUMAN (O95947) T-box transcription factor TBX6 (T-box protein 6)| Length = 436 Score = 31.6 bits (70), Expect = 0.47 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +2 Query: 260 PDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAEAFRLPFVPPYLGGGDF 406 PD RS PY F P G G + A +PF P +L GG F Sbjct: 374 PDSGRSAPYSAAFLDVPHGSGGSG-----YPAAPPAVPFAPHFLQGGPF 417
>GCAT_AERHY (P10480) Phosphatidylcholine-sterol acyltransferase precursor (EC| 2.3.1.43) (Glycerophospholipid-cholesterol acyltransferase) (GCAT) Length = 335 Score = 29.3 bits (64), Expect = 2.3 Identities = 21/60 (35%), Positives = 27/60 (45%) Frame = +2 Query: 185 FDRIFSFGDSLTDTGNFLLSVPDDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAEAF 364 F RI FGDSL+DTG + P S PY + GR+S+G L+ F Sbjct: 25 FSRIVMFGDSLSDTGKMYSKMRGYLPS---SPPYYE-------GRFSNGPVWLEQLTNEF 74
>RPIA_SYNEL (Q8DJF2) Ribose-5-phosphate isomerase A (EC 5.3.1.6)| (Phosphoriboisomerase A) (PRI) Length = 236 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +2 Query: 206 GDSLTDTGNFLLSVP-DDFPDPA 271 G +TD GNF+L V DD PDPA Sbjct: 172 GPVVTDQGNFVLDVRFDDIPDPA 194
>YRRI_BACSU (O34472) Hypothetical UPF0118 protein yrrI| Length = 353 Score = 27.3 bits (59), Expect = 8.8 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 6/53 (11%) Frame = +2 Query: 251 DDFPDPA-----RSLPYGQTFF-GRPSGRYSDGRNLLDFFAEAFRLPFVPPYL 391 DD+PD + + + FF G G S RN+LD+F A +PF+ Y+ Sbjct: 126 DDWPDGMHHRIDKMIRQTEAFFAGTIEGAISGIRNVLDYFLIAATIPFLVFYM 178
>GDE_RABIT (P35574) Glycogen debranching enzyme (Glycogen debrancher) [Includes:| 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (EC 3.2.1.33) (Amylo-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase)] Length = 1555 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 311 SGRYSDGRNLLDFFAEAFRLPFVPPYLGGGDF 406 +GRY + RN++ FA R +P LG G + Sbjct: 1137 TGRYLEARNIILAFAGTLRHGLIPNLLGEGTY 1168
>GDE_CANFA (Q2PQH8) Glycogen debranching enzyme (Glycogen debrancher) [Includes:| 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (EC 3.2.1.33) (Amylo-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase)] Length = 1533 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 311 SGRYSDGRNLLDFFAEAFRLPFVPPYLGGGDF 406 +GRY + RN++ FA R +P LG G + Sbjct: 1115 TGRYLEARNIILAFAGTLRHGLIPNLLGEGTY 1146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,243,107 Number of Sequences: 219361 Number of extensions: 531316 Number of successful extensions: 2191 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2189 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)