| Clone Name | bast63e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1 | 34 | 0.074 | 2 | SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1... | 32 | 0.37 | 3 | YWY3_CAEEL (Q11090) Putative serine/threonine-protein kinase C01... | 28 | 5.3 |
|---|
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 34.3 bits (77), Expect = 0.074 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 69 HSAAETAAPRPRAQ*KGASPQRMYGAGWSRPTQREGR 179 HS + +A+P PR + K SP+ G W P + GR Sbjct: 523 HSPSRSASPSPRKRQKETSPRMQMGKRWQSPVTKSGR 559
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 32.0 bits (71), Expect = 0.37 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 69 HSAAETAAPRPRAQ*KGASPQRMYGAGWSRPTQREGR 179 HS + +A+P PR + K SP+ G W P + R Sbjct: 521 HSPSRSASPSPRKRQKETSPRMQMGKRWQSPVTKSSR 557
>YWY3_CAEEL (Q11090) Putative serine/threonine-protein kinase C01C4.3 (EC| 2.7.11.1) Length = 407 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 115 FYCARGRGAAVSAALCACQGWSWLEWQRQRLAARP 11 FYC +G+ A++ W W +W +++ A P Sbjct: 322 FYCMKGKFPWQKASIMCKPYWEWEQWLKRKNPALP 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,843,289 Number of Sequences: 219361 Number of extensions: 464675 Number of successful extensions: 1132 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1132 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)