| Clone Name | bast63e06 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 110 RCTHPARSGCQGRKGNQIRRKSCRGQFSAW 21 RC P SGC+GR G+ C G W Sbjct: 1165 RCQRPGASGCEGRGGDGTCDAGCSGPGGDW 1194
>GSA_CHLRE (Q39566) Glutamate-1-semialdehyde 2,1-aminomutase, chloroplast| precursor (EC 5.4.3.8) (GSA) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) Length = 463 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 14 RESTRKIARGNFSGGFGFPFCLGIHSLLGECTSAST 121 +E + +I GN SG FGF FC G + + +A T Sbjct: 378 KEHSHEITGGNISGMFGFFFCKGPVTCFEDALAADT 413
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 110 RCTHPARSGCQGRKGNQIRRKSCRGQFSAW 21 RC P GC+GR G+ C G W Sbjct: 1169 RCQKPGAKGCEGRSGDGACDAGCSGPGGNW 1198
>CDC5_YEAST (P32562) Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC| 2.7.11.21) Length = 705 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 38 RGNFSGGFGFPFCLGIHSLLGECTSASTLV*IQYYSTKTRRSIQDAI 178 RG+F G GF C I GE +A T+ S KTR+ + I Sbjct: 84 RGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEI 130
>PHNS_DESGI (P12943) Periplasmic [NiFe] hydrogenase small subunit precursor (EC| 1.12.2.1) (NiFe hydrogenlyase small chain) Length = 288 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 31 NCPRQLFRRIWFPFLPWHPLLA 96 NCP+QLF ++ +P HP +A Sbjct: 251 NCPKQLFNQVNWPVQAGHPCIA 272
>PRP5_USTMA (Q4PFD9) Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (EC| 3.6.1.-) Length = 1156 Score = 27.7 bits (60), Expect = 7.1 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 22 HAENCPRQLFRRIWFPFLPWHPLLAG*VHLS--FYSSLDTIL 141 H E PRQ RR W P P A VH+S SSL+T L Sbjct: 105 HVEGAPRQGGRRRWDEGAPTPPTAAAPVHVSDPTRSSLNTQL 146
>TEGU_EBV (P03186) Large tegument protein| Length = 3149 Score = 27.7 bits (60), Expect = 7.1 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +3 Query: 21 PRGKLPAATFPADLVSLSALASTPCWVSAPQLLL*SRYNIILQRRGD 161 P +P AT P L S SAL W PQLL + +LQ GD Sbjct: 1657 PPPTIPQATAPPRLASDSAL-----WPKKPQLLTRRERDDLLQATGD 1698
>EF1G_TRYCR (P34715) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)| Length = 411 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -1 Query: 81 PRQKGKPNPPEKLPRAIFRVDS 16 PR+K KPNP ++LP + F +D+ Sbjct: 250 PREKKKPNPLDELPPSPFVLDA 271 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,034,713 Number of Sequences: 219361 Number of extensions: 737040 Number of successful extensions: 2583 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2583 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)