| Clone Name | bast63e03 |
|---|---|
| Clone Library Name | barley_pub |
>FOLR2_HUMAN (P14207) Folate receptor beta precursor (FR-beta) (Folate receptor| 2) (Folate receptor, fetal/placental) (Placental folate-binding protein) (FBP) Length = 255 Score = 30.0 bits (66), Expect = 2.6 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -3 Query: 382 WSSQLRSRSTWSKSRLLLTMRCLERAV-WWRETEIQSWV*SRWKRSVDSTKRLSRSPS 212 W Q+ TW K R L C E WW + S W R D T +++ P+ Sbjct: 110 WIQQVNQ--TWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPA 165
>POLS_RUBVT (P07566) Structural polyprotein [Contains: Nucleocapsid protein C;| Membrane glycoprotein E2; Membrane glycoprotein E1] Length = 1063 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +2 Query: 332 QEPRFRPGR----PRAQLGRPDHPDGAAVLRG 415 Q PR + GR PR +LG P +P AAV RG Sbjct: 105 QPPRMQTGRGGSAPRPELGPPTNPFQAAVARG 136
>POLS_RUBVR (P19725) Structural polyprotein [Contains: Nucleocapsid protein C;| Membrane glycoprotein E2; Membrane glycoprotein E1] Length = 1063 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +2 Query: 332 QEPRFRPGR----PRAQLGRPDHPDGAAVLRG 415 Q PR + GR PR +LG P +P AAV RG Sbjct: 105 QPPRMQTGRGGSAPRPELGPPTNPFQAAVARG 136
>POLS_RUBVH (P21480) Structural polyprotein [Contains: Nucleocapsid protein C;| Membrane glycoprotein E2; Membrane glycoprotein E1] Length = 1063 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +2 Query: 332 QEPRFRPGR----PRAQLGRPDHPDGAAVLRG 415 Q PR + GR PR +LG P +P AAV RG Sbjct: 105 QPPRMQTGRGGSAPRPELGPPTNPFQAAVARG 136
>POLS_RUBVM (P08563) Structural polyprotein [Contains: Nucleocapsid protein C;| Membrane glycoprotein E2; Membrane glycoprotein E1] Length = 992 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +2 Query: 332 QEPRFRPGR----PRAQLGRPDHPDGAAVLRG 415 Q PR + GR PR +LG P +P AAV RG Sbjct: 104 QPPRMQTGRGGSAPRPELGPPTNPFQAAVARG 135
>XYLA_STRRO (P22857) Xylose isomerase (EC 5.3.1.5)| Length = 393 Score = 28.5 bits (62), Expect = 7.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 78 RTMASKPGPLTRWPWHDMGNYKYALVAPWAAYSTYRFAAATARG 209 R AS P T WP + + AL+A A+ + AA ARG Sbjct: 324 RRRASAPRVWTSWPSRPLADGLEALLADRTAFEDFDVEAAAARG 367 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,472,760 Number of Sequences: 219361 Number of extensions: 635505 Number of successful extensions: 2402 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2400 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)