| Clone Name | bast63b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y10K_MSVS (P14992) Hypothetical 10.9 kDa protein | 29 | 7.5 |
|---|
>Y10K_MSVS (P14992) Hypothetical 10.9 kDa protein| Length = 101 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 359 SSPGTGGAPWLR*GWEVILSVDILMAVYLVRL 454 ++P +GG PW R G ILS L+ YL+ L Sbjct: 16 AAPTSGGVPWSRVGEVAILSFVALICFYLLYL 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,662,555 Number of Sequences: 219361 Number of extensions: 563238 Number of successful extensions: 1745 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1745 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)