| Clone Name | bast62h05 |
|---|---|
| Clone Library Name | barley_pub |
>ALLC_BRARE (Q6DGA6) Allantoicase (EC 3.5.3.4) (Allantoate amidinohydrolase)| Length = 395 Score = 32.7 bits (73), Expect = 0.21 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 56 GGEGTANNYLSLSLPHRITHTR 121 G T +NYLS+S PHR+TH R Sbjct: 161 GYSDTCHNYLSVSYPHRVTHIR 182
>HIRA_DROME (O17468) HIRA protein homolog (dHIRA)| Length = 1047 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 102 CGSDRER*LFAVPSPPLQLCSSGGG 28 C S+R++ +FA P+PP Q +S G Sbjct: 873 CKSERQKDIFATPAPPQQKTASSAG 897
>PO3F4_RAT (P62516) POU domain, class 3, transcription factor 4| (Brain-specific homeobox/POU domain protein 4) (Brain-4) (Brn-4) (RHS2 class III POU protein) Length = 361 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +1 Query: 67 NRKQLSLSITPA----PHNPHTHNVHTDHSC 147 NR+Q +TP PH ++H V TD SC Sbjct: 328 NRRQKEKRMTPPGDQQPHEVYSHTVKTDASC 358
>PO3F4_MOUSE (P62515) POU domain, class 3, transcription factor 4| (Brain-specific homeobox/POU domain protein 4) (Brain-4) (Brn-4) Length = 361 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +1 Query: 67 NRKQLSLSITPA----PHNPHTHNVHTDHSC 147 NR+Q +TP PH ++H V TD SC Sbjct: 328 NRRQKEKRMTPPGDQQPHEVYSHTVKTDASC 358
>PO3F4_MESAU (Q812B1) POU domain, class 3, transcription factor 4| (Brain-specific homeobox/POU domain protein 4) (Brain-4) (Brn-4) Length = 361 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +1 Query: 67 NRKQLSLSITPA----PHNPHTHNVHTDHSC 147 NR+Q +TP PH ++H V TD SC Sbjct: 328 NRRQKEKRMTPPGDQQPHEVYSHTVKTDASC 358
>PO3F4_HUMAN (P49335) POU domain, class 3, transcription factor 4| (Brain-specific homeobox/POU domain protein 4) (Brain-4) (Brn-4) Length = 361 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +1 Query: 67 NRKQLSLSITPA----PHNPHTHNVHTDHSC 147 NR+Q +TP PH ++H V TD SC Sbjct: 328 NRRQKEKRMTPPGDQQPHEVYSHTVKTDTSC 358
>GPMI_METMA (Q8PYF8) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 521 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 37 GGAKLQGGRGNRKQLSLSITPAPHNPHTHN 126 G A + GN +Q+ S T PH HT N Sbjct: 444 GAALITADHGNAEQMENSHTGEPHTAHTSN 473 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.135 0.480 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,202,029 Number of Sequences: 219361 Number of extensions: 506323 Number of successful extensions: 1619 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1617 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)