| Clone Name | bast62h01 |
|---|---|
| Clone Library Name | barley_pub |
>YDCU_ECOLI (P77156) Inner membrane ABC transporter permease protein ydcU| Length = 313 Score = 28.9 bits (63), Expect = 3.3 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +2 Query: 155 PGALRQRAADIGARSRQLQSRRLWTYALTFGCAAGFVVTVLATIQDQLV 301 P +L Q +AD+GAR RQ + A+ G AAG + T T+ D +V Sbjct: 211 PPSLLQASADLGARPRQTFRYVVLPLAIP-GIAAGSIFTFSLTLGDFIV 258
>YCF4_CHAGL (Q8M9X4) Photosystem I assembly protein ycf4| Length = 184 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 185 IGARSRQLQSRRLWTYALTFGCAAGFVVTVLATIQDQLVFYLTPTDAL 328 IGAR S W + G F+V V + +Q +VF+L+ +D L Sbjct: 14 IGARRL---SNYFWATVVFLGSLGFFIVGVSSYLQKNIVFFLSASDIL 58
>HLYB_PROVU (P11599) Alpha-hemolysin translocation ATP-binding protein hlyB| Length = 707 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 209 QSRRLWTYALTFGCAAGFVVTVLATIQDQ 295 Q +W L AAGF VTVLATI Q Sbjct: 351 QMTNIWDKQLAGYVAAGFKVTVLATIGQQ 379
>HLYB_ECOL6 (Q8FDZ8) Alpha-hemolysin translocation ATP-binding protein hlyB| Length = 707 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 209 QSRRLWTYALTFGCAAGFVVTVLATIQDQ 295 Q +W L AAGF VTVLATI Q Sbjct: 351 QMTNIWDKQLAGYVAAGFKVTVLATIGQQ 379
>HLYBP_ECOLI (P08716) Alpha-hemolysin translocation ATP-binding protein hlyB| Length = 707 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 209 QSRRLWTYALTFGCAAGFVVTVLATIQDQ 295 Q +W L AAGF VTVLATI Q Sbjct: 351 QMTNIWDKQLAGYVAAGFKVTVLATIGQQ 379
>HLYBC_ECOLI (P10089) Alpha-hemolysin translocation ATP-binding protein hlyB| Length = 707 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 209 QSRRLWTYALTFGCAAGFVVTVLATIQDQ 295 Q +W L AAGF VTVLATI Q Sbjct: 351 QMTNIWDKQLAGYVAAGFKVTVLATIGQQ 379
>HLYB3_ECOLI (Q47258) Alpha-hemolysin translocation ATP-binding protein hlyB| Length = 707 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 209 QSRRLWTYALTFGCAAGFVVTVLATIQDQ 295 Q +W L AAGF VTVLATI Q Sbjct: 351 QMTNIWDKQLAGYVAAGFKVTVLATIGQQ 379 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.298 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,846,596 Number of Sequences: 219361 Number of extensions: 234771 Number of successful extensions: 408 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 44 (21.8 bits)