| Clone Name | bast62f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline... | 33 | 0.33 | 2 | BCAR1_HUMAN (P56945) Breast cancer anti-estrogen resistance prot... | 30 | 3.7 | 3 | SAS_DROME (Q04164) Putative epidermal cell surface receptor prec... | 29 | 4.8 | 4 | BCAR1_RAT (Q63767) Breast cancer anti-estrogen resistance protei... | 28 | 8.2 |
|---|
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 33.1 bits (74), Expect = 0.33 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 18 QPIPPSFLPSTPRRIRLLPVPEEE 89 QP+PP+F P PRRI L P P + Sbjct: 496 QPLPPTFSPPPPRRIHLPPPPHRQ 519 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 3 PTHLHQPIPPSFLPSTPRRIRLLPVP 80 PT+ P PP+F P PR+I P P Sbjct: 525 PTYGQPPSPPTFSPPPPRQIHSPPPP 550
>BCAR1_HUMAN (P56945) Breast cancer anti-estrogen resistance protein 1| (CRK-associated substrate) (p130cas) Length = 870 Score = 29.6 bits (65), Expect = 3.7 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 9/45 (20%) Frame = +3 Query: 12 LHQPIPPS-----FLPST----PRRIRLLPVPEEEDEALHAVAGP 119 LH P PP+ LP+T P + L+P P + + L+ V GP Sbjct: 89 LHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGP 133
>SAS_DROME (Q04164) Putative epidermal cell surface receptor precursor| (Stranded at second protein) Length = 1693 Score = 29.3 bits (64), Expect = 4.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 24 IPPSFLPSTPRRIRLLPVPEEE 89 +PP+ LP P RLLP+P++E Sbjct: 873 LPPADLPCHPALARLLPIPDDE 894
>BCAR1_RAT (Q63767) Breast cancer anti-estrogen resistance protein 1| (CRK-associated substrate) (p130cas) Length = 968 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 9/48 (18%) Frame = +3 Query: 3 PTHLHQPIPPS-----FLPST----PRRIRLLPVPEEEDEALHAVAGP 119 P +H P+PP+ LP+ P + L+P P + + L+ GP Sbjct: 184 PQGVHTPVPPASQYSPMLPTAYQPQPDNVYLVPTPSKTQQGLYQAPGP 231 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,451,960 Number of Sequences: 219361 Number of extensions: 261942 Number of successful extensions: 1069 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)