| Clone Name | bast62e10 |
|---|---|
| Clone Library Name | barley_pub |
>ZMAT2_MOUSE (Q9CPW7) Zinc finger matrin type 2| Length = 199 Score = 51.6 bits (122), Expect = 9e-07 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +3 Query: 264 SGVDNT-FRRKFDKEEYLERARQRERDEKDEARRGKDRGP--PVQRQPLKHRDYEXDLES 434 SG N FRRK+DK+EY + A +R +E+++ KD P PV+R+ L+HRDY+ DLES Sbjct: 5 SGTKNLDFRRKWDKDEYEKLAEKRLTEEREK----KDGKPVQPVKRELLRHRDYKVDLES 60 Query: 435 RL 440 +L Sbjct: 61 KL 62
>ZMAT2_HUMAN (Q96NC0) Zinc finger matrin type 2| Length = 199 Score = 51.6 bits (122), Expect = 9e-07 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +3 Query: 264 SGVDNT-FRRKFDKEEYLERARQRERDEKDEARRGKDRGP--PVQRQPLKHRDYEXDLES 434 SG N FRRK+DK+EY + A +R +E+++ KD P PV+R+ L+HRDY+ DLES Sbjct: 5 SGTKNLDFRRKWDKDEYEKLAEKRLTEEREK----KDGKPVQPVKRELLRHRDYKVDLES 60 Query: 435 RL 440 +L Sbjct: 61 KL 62
>YO14_CAEEL (P34670) Putative zinc finger protein ZK686.4| Length = 407 Score = 40.0 bits (92), Expect = 0.003 Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKD--EARRGKDRG--PPVQRQPLKHRDYEXDLESRL 440 RR +D++EY A+QR DEK+ + R GK + P V+R+ L+ R+Y+ DL+S++ Sbjct: 207 RRTWDEKEYSLAAQQRLLDEKEAEDIRLGKKKKDEPKVKREMLQAREYKVDLDSKV 262
>HXA9_MOUSE (P09631) Homeobox protein Hox-A9 (Hox-1.7)| Length = 271 Score = 35.8 bits (81), Expect = 0.049 Identities = 25/62 (40%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -3 Query: 423 HXHNPY----ASKAVFAQEGPYPCLSWLRPSHPALSVELAPSTPPCQISFGKCCPRRKDC 256 H H+PY A A A +G Y SWL P+ ALS PS+ P I RR DC Sbjct: 85 HHHHPYVHPQAPVAAAAPDGRY-MRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDC 143 Query: 255 QT 250 T Sbjct: 144 PT 145
>HXA9_HUMAN (P31269) Homeobox protein Hox-A9 (Hox-1G)| Length = 272 Score = 35.8 bits (81), Expect = 0.049 Identities = 25/62 (40%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -3 Query: 423 HXHNPY----ASKAVFAQEGPYPCLSWLRPSHPALSVELAPSTPPCQISFGKCCPRRKDC 256 H H+PY A A A +G Y SWL P+ ALS PS+ P I RR DC Sbjct: 86 HHHHPYVHPQAPVAAAAPDGRY-MRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDC 144 Query: 255 QT 250 T Sbjct: 145 PT 146
>RBM25_HUMAN (P49756) Probable RNA-binding protein 25 (RNA-binding motif protein| 25) (RNA-binding region-containing protein 7) (Protein S164) Length = 784 Score = 34.3 bits (77), Expect = 0.14 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R+ ++E ER R+RER+ + E R ++R +R+ K RD E D E Sbjct: 332 REREREREREREREREREREREREREREREREREREKDKKRDREEDEE 379 Score = 31.6 bits (70), Expect = 0.91 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 D+E ER R+RER+ + E R ++R +R+ + +D + D E Sbjct: 331 DREREREREREREREREREREREREREREREREREREKDKKRDRE 375 Score = 31.6 bits (70), Expect = 0.91 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R + ++E ER R+RE++++ E R +DR R K RD + D E Sbjct: 261 RERREREREREREREREKEKERERERERDR----DRDRTKERDRDRDRE 305 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R+ ++E ER +++ER+ + E R +DR R + RD + D E Sbjct: 266 REREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRE 313 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 R +K ER R+RER+ + E R ++R +R+ + R+ E D Sbjct: 324 RSREKSRDREREREREREREREREREREREREREREREREREREKD 369 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 D R +E+ +R R+RER+ + E R ++R +R+ + R+ E + + + Sbjct: 317 DRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKK 371 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 R+ ++E+ ER R+RERD + + +DR +R + R+ D Sbjct: 272 REREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSD 317
>SFR12_HUMAN (Q8WXA9) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) (Splicing regulatory protein 508) (SRrp508) Length = 508 Score = 33.5 bits (75), Expect = 0.24 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 KE+ E+ R+RE++ + E RGK++ +R+ + +D E D E Sbjct: 275 KEKDREKEREREKEREKEKERGKNKDRDKEREKDREKDKEKDRE 318 Score = 33.1 bits (74), Expect = 0.31 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 +KE E+ R++ER+ + E + K+RG R + +D E D E Sbjct: 270 EKERVKEKDREKEREREKEREKEKERGKNKDRDKEREKDREKDKE 314 Score = 31.6 bits (70), Expect = 0.91 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 +RK +E+ E+ R +E+D + E R K+R +R K RD E + Sbjct: 260 KRKDTREKIKEKERVKEKDREKEREREKEREKEKERGKNKDRDKERE 306 Score = 30.8 bits (68), Expect = 1.6 Identities = 13/55 (23%), Positives = 31/55 (56%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 D R+ D+E+ E+ R+RER+++ E R K++ ++ + +D +++ + Sbjct: 300 DRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEK 354 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R+ ++E+ ER + ++RD++ E R KD+ +R+ K + + D E Sbjct: 285 REKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKE 332
>GAG_MSVMO (P03334) Gag polyprotein R65 [Contains: Core protein p15; Inner| coat protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 33.5 bits (75), Expect = 0.24 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RER+EK+E RR +D +R +HR+ Sbjct: 427 ERIFNKRETPEEREERIR-REREEKEERRRTEDEQKEKERDRRRHRE 472
>K0853_HUMAN (Q5T200) Protein KIAA0853| Length = 1668 Score = 32.7 bits (73), Expect = 0.41 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 R+ D+E ER R+R+R+ + E ++R +R+ K RD E D Sbjct: 683 RERDRERERERERERDREREKERELERERAREREREREKERDRERD 728 Score = 32.0 bits (71), Expect = 0.70 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R+ +KE LER R RER+ + E R ++R + R+ E D E Sbjct: 699 REREKERELERERAREREREREKERDRERDRDRDHDRERERERERDRE 746 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R+ ++E ERAR+RER+ + E R +DR R+ + R+ + + E Sbjct: 701 REKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKE 748 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYE 419 R + ++E ER R+RER+ + E R ++R +RQ RD+E Sbjct: 751 REREERERERERERERERERERERERARERDKERERQ----RDWE 791 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKD---EARRGKDRGPPVQRQPLKHRDYEXD 425 D+ R+ ++E E+ R+RER+E++ E R ++R +R+ + RD E + Sbjct: 732 DHDRERERERERDREKEREREREERERERERERERERERERERERARERDKERE 785 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 D R +++ ER R+RER+ + E R +++ ++R+ + R+ E + E Sbjct: 670 DRRDERARERDRERERDRERERERERERDREREKERELERERAREREREREKE 722 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDR--GPPVQRQPLKHRD 413 D + R D++ ER R+RERD++ + R ++R V+R + RD Sbjct: 1328 DKDWPRNRDRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRD 1376 Score = 28.5 bits (62), Expect = 7.7 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 R K + E ER R+RER+ + E R ++R +R K R+ + D E + Sbjct: 745 REKEREREREERERERERERERERERERERERARERD--KERERQRDWEDK 793 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 270 VDNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 VD R+ ++ +R R+R+R+ + E R +DR +R+ + R E + E Sbjct: 665 VDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERE 718
>K0182_HUMAN (Q14687) Protein KIAA0182 (Fragment)| Length = 1157 Score = 32.3 bits (72), Expect = 0.54 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +3 Query: 270 VDNTFRRKFDKEEYLERARQ--RERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 +D RR+ ++E ER R+ RER+++ E R K+R +R+ K R+ E + Sbjct: 273 MDEELRREREREREREREREADREREKEREREREKEREQEKEREREKERERELE 326 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R + D+E ER R+RER+ + EA R +++ +R+ + ++ E + E Sbjct: 270 RLQMDEELRREREREREREREREADREREKEREREREKEREQEKERERE 318 Score = 29.6 bits (65), Expect = 3.5 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQ 395 ++E+ ER R++ER+++ E R K+R ++RQ Sbjct: 296 EREKEREREREKEREQEKEREREKERERELERQ 328 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESRL 440 +E ER R+RER+ E + ++R +R+ K R+ E + E L Sbjct: 279 REREREREREREREADREREKEREREREKEREQEKEREREKEREREL 325
>RED_MOUSE (Q9Z1M8) Protein Red (Protein RER) (IK factor) (Cytokine IK)| Length = 557 Score = 32.0 bits (71), Expect = 0.70 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYE 419 R ++E Y ER R RERD E R +DR +R + R+ E Sbjct: 334 RDKERERYRERERDRERDRDRERDRERDRERERERDREREREEE 377 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = +3 Query: 270 VDNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 V +T + DKE ER R+RERD + + R +DR +R+ + R+ E + E + Sbjct: 326 VPSTTKTPRDKER--ERYRERERDRERDRDRERDRERDRERERERDREREREEEKK 379
>PSME1_PIG (Q64L94) Proteasome activator complex subunit 1 (Proteasome| activator 28-alpha subunit) (PA28alpha) (PA28a) Length = 249 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/30 (43%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRG--KDRGPP 383 ++E ER +Q+E+++KDE ++G +D+GPP Sbjct: 71 EKEKEERKKQQEKEDKDEKKKGEDEDKGPP 100
>PSME1_HUMAN (Q06323) Proteasome activator complex subunit 1 (Proteasome| activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) (Interferon gamma up-regulated I-51 Length = 249 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/30 (43%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRG--KDRGPP 383 ++E ER +Q+E+++KDE ++G +D+GPP Sbjct: 71 EKEKEERKKQQEKEDKDEKKKGEDEDKGPP 100
>PSME1_BOVIN (Q4U5R3) Proteasome activator complex subunit 1 (Proteasome| activator 28-alpha subunit) (PA28alpha) (PA28a) Length = 249 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/30 (43%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRG--KDRGPP 383 ++E ER +Q+E+++KDE ++G +D+GPP Sbjct: 71 EKEKEERRKQQEKEDKDEKKKGEDEDKGPP 100
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 32.0 bits (71), Expect = 0.70 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR +D +R +HR+ Sbjct: 427 EKIFNKRETPEEREERVR-RETEEKEERRRAEDERREKERDRRRHRE 472
>IF3A_HUMAN (Q14152) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3| theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (eIF3a) Length = 1382 Score = 32.0 bits (71), Expect = 0.70 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRG 377 DN R + DK+ ER R+R+ D +D RR +D G Sbjct: 1212 DNQDREENDKDPERERDRERDVDREDRFRRPRDEG 1246
>U33K_HUMAN (Q04323) UBA/UBX 33.3 kDa protein| Length = 297 Score = 32.0 bits (71), Expect = 0.70 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQP 398 RR+ EE R R RE+ E+D+A R K G V QP Sbjct: 150 RRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQP 187
>GAG_MLVDU (P23090) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 528 Score = 31.6 bits (70), Expect = 0.91 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR +D +R +HR+ Sbjct: 418 EKIFNKRETPEEREERIR-RETEEKEERRRAEDEQREKERDRRRHRE 463
>GAG_MLVDE (P29168) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 31.6 bits (70), Expect = 0.91 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR +D +R +HR+ Sbjct: 425 EKIFNKRETPEEREERIR-RETEEKEERRRAEDEQREKERDRRRHRE 470
>PSME1_MACFA (P58238) Proteasome activator complex subunit 1 (Proteasome| activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) Length = 249 Score = 31.6 bits (70), Expect = 0.91 Identities = 13/30 (43%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRG--KDRGPP 383 ++E ER +Q+E+++KDE ++G +D+GPP Sbjct: 71 EKEKGERKKQQEKEDKDEKKKGEDEDKGPP 100
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 31.6 bits (70), Expect = 0.91 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR +D +R +HR+ Sbjct: 428 EKIFNKRETPEEREERIR-RETEEKEERRRAEDEQREKERDRRRHRE 473
>SFR12_RAT (Q9JKL7) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) (SR-related protein of 86 kDa) Length = 494 Score = 31.6 bits (70), Expect = 0.91 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 KE ER R++E++ + E + K+RG + K +D+E + Sbjct: 272 KERVKEREREKEKEREKEREKDKERGKNKDKDREKEKDHEKE 313 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 ++E E+ R++ER++ E + KD+ ++ K RD E + E Sbjct: 277 EREREKEKEREKEREKDKERGKNKDKDREKEKDHEKERDKEKEKE 321
>RED_HUMAN (Q13123) Protein Red (Protein RER) (IK factor) (Cytokine IK)| Length = 557 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = +3 Query: 270 VDNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 V +T + DKE ER R+RERD + + R ++R R+ + RD E + E + Sbjct: 326 VPSTTKTPRDKER--ERYRERERDRERDRDRDRERERERDRERERERDREREEEKK 379
>GAG_MLVMO (P03332) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR +D +R +HR+ Sbjct: 427 EKIFNKRETPEEREERIR-RETEEKEERRRTEDEQKEKERDRRRHRE 472
>PPIL4_CRYNE (Q5KNY5) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 504 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 291 KFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 K D+E +R R RER+ RR +DR R P + RD E D R Sbjct: 417 KRDRERSPKRERDRERERDRSPRRDRDR--ERDRSPRRDRDRERDDHDR 463
>NELFE_MOUSE (P19426) Negative elongation factor E (NELF-E) (RD protein)| Length = 375 Score = 30.8 bits (68), Expect = 1.6 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERD-EKDEAR-RGKDRGPPVQRQPLKHRDYEXDLE 431 D + R DKE +R R R+RD +KD+ R R +DR R + RD E D E Sbjct: 193 DRSRDRDRDKERDRDRDRDRDRDRDKDKDRDRDRDRDKERDRDRDRDRDRERDRE 247 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 D + R D++ ER R R+RD + + KDR R + RD + D Sbjct: 189 DRSHDRSRDRDRDKERDRDRDRDRDRDRDKDKDRDRDRDRDKERDRDRDRD 239
>GAG_MLVCB (P27460) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER + RE +EK+E RR +D +R +HR+ Sbjct: 425 EKIFNKRETPEEREERIK-RETEEKEERRRAEDEQKEKERDRRRHRE 470
>PSME1_MOUSE (P97371) Proteasome activator complex subunit 1 (Proteasome| activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) Length = 249 Score = 30.8 bits (68), Expect = 1.6 Identities = 13/30 (43%), Positives = 23/30 (76%), Gaps = 2/30 (6%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRGK--DRGPP 383 ++E ER +Q+E++EK+E ++G D+GPP Sbjct: 71 EKEKEERKKQQEKEEKEEKKKGDEDDKGPP 100
>T2_MOUSE (Q06666) Octapeptide-repeat protein T2| Length = 185 Score = 30.8 bits (68), Expect = 1.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 315 ERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYE 419 ER R+R+R + E +RG++RG +R+ + R E Sbjct: 26 ERQRERQRGREAERQRGRERGREAEREAERQRGRE 60
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 30.8 bits (68), Expect = 1.6 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGP 380 DKE+ +R R RERD++D+AR ++ P Sbjct: 10 DKEKDRDRDRDRERDKRDKARESENARP 37
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 30.8 bits (68), Expect = 1.6 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGP 380 DKE+ +R R RERD++D+AR ++ P Sbjct: 10 DKEKDRDRDRDRERDKRDKARESENARP 37
>RU17_XENLA (P09406) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 267 GVDNTFRRKFDKEEYLERARQRERD-EKDEARRGKDRGPPVQRQPLKHRDYEXD 425 G+D ++ +E+ ER R+R+RD EK E R KDR R+ HRD + + Sbjct: 335 GIDGIELKQEPEEKSRERDRERDRDREKGEKDRDKDRDRDRDRR-RSHRDRDRE 387
>FIP1_MOUSE (Q9D824) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| Length = 581 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 261 PSGVDNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDY 416 PS VD T + + +R R RERD E R +DR R+ + RD+ Sbjct: 427 PSLVDTTKQWDYYARREKDRDRDRERDRDRERERDRDRERERTRERERERDH 478
>GAG_MLVAV (P03336) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 536 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR ++ +R +HR+ Sbjct: 426 ERIFNKRETPEEREERVR-RETEEKEERRRAEEEQKEKERDRRRHRE 471
>FIP1_RAT (Q5U317) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| Length = 536 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 261 PSGVDNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDY 416 PS VD T + + +R R RERD E R +DR R+ + RD+ Sbjct: 382 PSLVDTTKQWDYYARREKDRDRDRERDRDRERERDRDRERERTRERERERDH 433
>NELFE_HUMAN (P18615) Negative elongation factor E (NELF-E) (RD protein)| Length = 380 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 D + R D++ ER R R+RD E R +DR R+ + RD E D Sbjct: 189 DRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRE--RDRDRERD 237 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 R D++ +R R R+RD + + R +DR +R + RD + D E Sbjct: 196 RDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRERDRDRERDRDRDRE 243 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARRGKDRGPPVQR 392 R+ D++ +R R RERD E R +DR P +R Sbjct: 214 RERDRDRDRDRDRDRERDRDRERDRDRDREGPFRR 248
>GAG_MLVFF (P26806) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 30.4 bits (67), Expect = 2.0 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR +D +R +HR+ Sbjct: 427 EKIFNKRETPEEREERIR-RETEEKEERRRAEDVQREKERDRRRHRE 472
>IF3A_MOUSE (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3| theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (eIF3a) (p162 protein) (Centrosomin) Length = 1344 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRG 377 DN R + DK+ +R R+R+ D +D RR +D G Sbjct: 1173 DNQDREENDKDLERDRDRERDGDREDRFRRPRDEG 1207
>SFR12_MOUSE (Q8BZX4) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) Length = 494 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 +KE ER R+++R++ E + KD+ ++ K RD E + E Sbjct: 277 EKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKE 321 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 300 KEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 KE E+ R++ER+ + + + K+RG + K +D+E + Sbjct: 272 KERVKEKEREKEREREKDREKDKERGKNKDKDREKEKDHEKE 313 Score = 28.9 bits (63), Expect = 5.9 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 +RK +E+ ER +++ER++ E R KDR +R K +D E + Sbjct: 263 KRKDTREKVKERVKEKEREK--EREREKDREKDKERGKNKDKDREKE 307
>PRELP_HUMAN (P51888) Prolargin precursor (Proline-arginine-rich end| leucine-rich repeat protein) Length = 382 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -3 Query: 375 PYPCLSWLRPSHPALSVELAPSTPPCQISFGKCCPRRKDCQTSCP 241 P P S+ +P PA +L P PP S CPR C P Sbjct: 40 PRPTPSFPQPDEPAEPTDLPPPLPPGPPSIFPDCPRECYCPPDFP 84
>CROP_PONPY (Q5R8W6) Cisplatin resistance-associated overexpressed protein| Length = 432 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 D +++ + E E+ R+RER+E++ RR ++ +R+ + RD E SR Sbjct: 244 DERLKKEKQEREEREKEREREREERERKRRREEE----EREKERARDRERRKRSR 294
>CROP_MOUSE (Q5SUF2) Cisplatin resistance-associated overexpressed protein| Length = 432 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 D +++ + E E+ R+RER+E++ RR ++ +R+ + RD E SR Sbjct: 244 DERLKKEKQEREEREKEREREREERERKRRREEE----EREKERARDRERRKRSR 294
>CROP_HUMAN (O95232) Cisplatin resistance-associated overexpressed protein| (cAMP regulatory element associated protein 1) (CRE-associated protein 1) (CREAP-1) (Luc7A) (Okadaic acid-inducible phosphoprotein OA48-18) Length = 432 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 D +++ + E E+ R+RER+E++ RR ++ +R+ + RD E SR Sbjct: 244 DERLKKEKQEREEREKEREREREERERKRRREEE----EREKERARDRERRKRSR 294
>CROP_BOVIN (Q3SX41) Cisplatin resistance-associated overexpressed protein| Length = 432 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 D +++ + E E+ R+RER+E++ RR ++ +R+ + RD E SR Sbjct: 244 DERLKKEKQEREEREKEREREREERERKRRREEE----EREKERARDRERRKRSR 294
>RU17_XENTR (Q66II8) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 30.0 bits (66), Expect = 2.7 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = +3 Query: 288 RKFDKEEYLERARQRER------DEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 R+ DKE R+R RER EK+E +R ++R + K +D E D Sbjct: 237 RERDKERERRRSRSRERRRRSRSREKEERKRSRERSRDKDKDKDKDKDKEKD 288 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEAR---RGKDRGPPVQRQPLKHRDYEXDLESR 437 RR+ E R+R RE++E+ +R R KD+ + K +D + D + R Sbjct: 245 RRRSRSRERRRRSRSREKEERKRSRERSRDKDKDKDKDKDKEKDKDKDRDRKRR 298
>GAG_MLVHO (P21435) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 539 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRD 413 + F ++ EE ER R RE +EK+E RR ++ +R +HR+ Sbjct: 429 ERIFNKRETPEEREERIR-RETEEKEERRRAENEQREKERDRRRHRE 474
>STC_DROME (P40798) Protein shuttle craft| Length = 1106 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Frame = +3 Query: 273 DNTFRRKFDKEEYLERARQRERDEKDEARRGKDR-----GPPVQRQPLKHRDYEXDLESR 437 ++ + R+ ++E +R R+R+RD + R +DR P + + DY D E R Sbjct: 230 NHNYERERERERDRDRDRERDRDRDRDRDRDRDRDRDRDSRPGNTRQQRRSDYRDDREDR 289
>GARP_PLAFF (P13816) Glutamic acid-rich protein precursor| Length = 678 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = +3 Query: 258 NPSGVDNTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHR 410 N +N+ +K DK+E + ++E+ EK + + KD+ ++ KH+ Sbjct: 109 NDKDNENSVDKKKDKKEKKHKKDKKEKKEKKDKKEKKDKKEKKHKKEKKHK 159
>PRELP_RAT (Q9EQP5) Prolargin precursor (Proline-arginine-rich end| leucine-rich repeat protein) Length = 377 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -3 Query: 375 PYPCLSWLRPSHPALSVELAPSTPPCQISFGKCCPRRKDCQTSCP 241 P P S+ +P PA +L P PP S CPR C P Sbjct: 35 PRPTPSFPQPHEPAEPTDLPPPLPPGPPSVFPDCPRECYCPPDFP 79
>TRHY_RABIT (P37709) Trichohyalin| Length = 1407 Score = 29.3 bits (64), Expect = 4.5 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Frame = +3 Query: 273 DNTFRRKFDKEEYL-------ERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 D RR++ K+E E+ ++RER E+ +R+ +D+ +QRQ L+ R E + Sbjct: 130 DEPERRRWQKQEQERELAEEEEQRKKRERFEQHYSRQYRDKEQRLQRQELEERRAEEE 187
>BRE1A_HUMAN (Q5VTR2) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 975 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +3 Query: 276 NTFRRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 N + K D+EE R++ER+ + E + K+R ++Q LK + E D Sbjct: 558 NEIKSKRDEEERERERREKEREREREREKEKER--EREKQKLKESEKERD 605
>U2AF2_CAEBR (P90727) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) (U2AF65) Length = 488 Score = 29.3 bits (64), Expect = 4.5 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEK----DEARRGKDRGPPVQRQPLKHRDYE 419 R +E +R+R R RD++ D+ RR + + P R+P K+R ++ Sbjct: 84 RSRSRERRRDRSRDRNRDDRRGGRDDDRRREPQEPAKPREPKKYRFWD 131
>ACINU_HUMAN (Q9UKV3) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1341 Score = 29.3 bits (64), Expect = 4.5 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEAR---RGKDRGPPVQRQPLK 404 RR+ +E ER R+RERD D R R ++RG R+ K Sbjct: 1280 RREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTK 1322
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGP 380 DKE+ +R R RER+++D+AR ++ P Sbjct: 10 DKEKDRDRDRDREREKRDKARESENSRP 37
>TIM_DROME (P49021) Protein timeless| Length = 1421 Score = 29.3 bits (64), Expect = 4.5 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -3 Query: 318 APSTPPCQISFGKCCPRRKDCQTS 247 +P Q++ GKCCP++++C +S Sbjct: 492 SPHAGQLQLTKGKCCPQKRECPSS 515
>CD2L1_HUMAN (P21127) PITSLRE serine/threonine-protein kinase CDC2L1 (EC| 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (Cell division cycle 2-like protein kinase 1) (CLK-1) (CDK11) (p58 CLK-1) Length = 795 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 RR+ D+ E LER R+RER +++ + +++ +R + ++ E E Sbjct: 162 RRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARRE 210
>NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2498 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 255 GNPSGVDNTFRRKFDKEEYLERARQRERDEKDEARRGKDR 374 G+P+ + N+ + ++E ER R RER EK++ R DR Sbjct: 1756 GHPAHLANSVSAERERERERERERDRER-EKEQRERESDR 1794
>MYO2_SCHPO (Q9USI6) Myosin type-2 heavy chain 1 (Myosin type II heavy chain 1)| Length = 1526 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESRL 440 DKEE L R ++R + +D K + +QR+ + +LES L Sbjct: 877 DKEEILRRTQERLANIEDSFSETKQQNENLQRESASLKQINNELESEL 924
>CWC25_EMENI (Q5B0I1) Pre-mRNA-splicing factor cwc25| Length = 415 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 17/66 (25%) Frame = +3 Query: 288 RKFDKEEYLERARQRERDEKDEARR-----------------GKDRGPPVQRQPLKHRDY 416 R+ ++E+ ER ++RER+ RR + R P V++ +HRD Sbjct: 162 RRREREQGRERHQERERERGHRHRRDSGNDSHRSHRHRRRSRSRSRSPRVEKDDRRHRDR 221 Query: 417 EXDLES 434 E D S Sbjct: 222 EHDRRS 227
>CD2L2_HUMAN (Q9UQ88) PITSLRE serine/threonine-protein kinase CDC2L2 (EC| 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (Cell division cycle 2-like protein kinase 2) (CDK11) Length = 780 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 RR+ D+ E LER R+RER +++ + +++ +R + ++ E E Sbjct: 150 RRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARRE 198
>TIM_DROVI (O17482) Protein timeless| Length = 1343 Score = 28.9 bits (63), Expect = 5.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 318 APSTPPCQISFGKCCPRRKDCQTSCPVH 235 +P Q+ GKCCP++++C +S H Sbjct: 436 SPHAGQLQLIKGKCCPQKRECPSSQSEH 463
>RU17_ARATH (Q42404) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 427 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 7/48 (14%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPV-------QRQPLKHRDYE 419 D++ R R R RD D RR +DRG R K RDYE Sbjct: 309 DRDRDSRRDRDRTRDRGDRDRRDRDRGRDRTSRDHDRDRSRKKERDYE 356
>RAD50_METKA (Q8TXI4) DNA double-strand break repair rad50 ATPase| Length = 876 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 297 DKEEYLERARQRERDEKDEARRGKDRGPPVQRQ 395 D E+ LER + RE D + E R KDR V+R+ Sbjct: 450 DAEKELERLQGREEDLRKERRELKDRLESVRRE 482
>RSP7_CAEEL (O01159) Probable splicing factor, arginine/serine-rich 7 (p54)| Length = 452 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYE 419 RR ++ ER+R R +D K + +R + R P K RD E Sbjct: 354 RRSKSRDRKRERSRSRSKDRKRDKKRSRSRSPE------KRRDKE 392
>GCP60_MOUSE (Q8BMP6) Golgi resident protein GCP60 (Acyl-CoA-binding| domain-containing protein 3) (Golgi phosphoprotein 1) (GOLPH1) (Golgi complex-associated protein 1) (GOCAP1) (PBR- and PKA-associated protein 7) (Peripherial benzodiazepine receptor-asso Length = 524 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXD 425 RRK ++E +RER +K+E +R +++ ++R+ + R E + Sbjct: 185 RRKAEEERRQREEEERERLQKEEEKRKREKEDRLRREEEERRRIEEE 231
>BRE1A_CHICK (Q5ZLS3) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 984 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/51 (25%), Positives = 30/51 (58%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLESR 437 R + ++E E+ +++ER+ + E + K+R +R+ K ++ E + ES+ Sbjct: 571 RERREREREREKEKEKEREREKEKEKEKER----EREKQKQKESEKERESK 617
>VIT6_CAEEL (P18948) Vitellogenin 6 precursor| Length = 1650 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 6/44 (13%) Frame = +3 Query: 276 NTFRRKFDKEEYLERARQRERDEKD------EARRGKDRGPPVQ 389 N R F+KEE +R + + +EKD E+RR +D P Q Sbjct: 1515 NYEREMFEKEENFQRIEKNQEEEKDQEMNYEESRREQDDEPTEQ 1558
>MYS_PODCA (Q05000) Myosin heavy chain (Fragment)| Length = 692 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 303 EEYLERARQRERDEKDEARRGKDRGPPVQRQP 398 E L++ARQR R A RG R P R P Sbjct: 651 EAALQKARQRARGASGSATRGASRAPSQPRTP 682
>U33K_MOUSE (Q922Y1) UBA/UBX 33.3 kDa protein| Length = 297 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPV 386 RR+ EE R R RE+ E+D+A R K G V Sbjct: 150 RRREKAEELAARQRVREKIERDKAERAKKYGGSV 183
>CD2L1_MOUSE (P24788) PITSLRE serine/threonine-protein kinase CDC2L1 (EC| 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (Cell division cycle 2-like protein kinase 1) Length = 784 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 285 RRKFDKEEYLERARQRERDEKDEARRGKDRGPPVQRQPLKHRDYEXDLE 431 RR+ D+ E LER R+RER +++ + +++ +R + ++ E E Sbjct: 162 RRERDRLEQLERKRERERKLREQQKEQREQKERERRAEERRKEREARRE 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,881,701 Number of Sequences: 219361 Number of extensions: 724782 Number of successful extensions: 3864 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 3168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3649 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)