| Clone Name | bast62e04 |
|---|---|
| Clone Library Name | barley_pub |
>PO2F2_PIG (Q29013) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 478 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 4 PSTHHLSPLTRASPFSTHRTTSIAKVRASQP 96 P T+H +P + SPFS T K++A P Sbjct: 38 PDTNHQNPQNKTSPFSVSPTGPSTKIKAEDP 68
>PO2F2_HUMAN (P09086) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 478 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 4 PSTHHLSPLTRASPFSTHRTTSIAKVRASQP 96 P T+H +P + SPFS T K++A P Sbjct: 37 PDTNHQNPQNKTSPFSVSPTGPSTKIKAEDP 67
>CD008_MOUSE (Q8CGI1) Protein C4orf008 homolog (Fragment)| Length = 944 Score = 29.3 bits (64), Expect = 4.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 23 LPSQEHRHSQPTAPRRSP 76 L ++HRHS P APR SP Sbjct: 656 LNKEDHRHSAPAAPRNSP 673
>CD008_HUMAN (P78312) Protein C4orf8 (Protein IT14)| Length = 1265 Score = 28.9 bits (63), Expect = 5.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 23 LPSQEHRHSQPTAPRRSP 76 + ++HRHS P APR SP Sbjct: 650 ISKEDHRHSAPAAPRNSP 667
>NADC_METTH (O27860) Probable nicotinate-nucleotide pyrophosphorylase| [carboxylating] (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) (QAPRTase) Length = 279 Score = 28.9 bits (63), Expect = 5.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 86 ARTLAIDVVRWVENGDALVRGER 18 AR +I ++RW ++GD L GER Sbjct: 52 AREFSISIIRWKDDGDPLSGGER 74
>FLGH_VIBF1 (Q5E3N0) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 263 Score = 28.1 bits (61), Expect = 9.4 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = -3 Query: 80 TLAIDVVRWVENGDALVRGERW 15 ++ ++V+ + NG+ L+RGE+W Sbjct: 180 SITVEVIEVLSNGNLLIRGEKW 201
>MAST2_MOUSE (Q60592) Microtubule-associated serine/threonine-protein kinase 2 (EC| 2.7.11.1) Length = 1734 Score = 28.1 bits (61), Expect = 9.4 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 1 LPSTHHL-SPLTRASPFSTHRTTSIAKVRASQPQRS*LARL 120 +PS HH SPL ASP S H +S R S P R L L Sbjct: 998 IPSEHHACSPL--ASPMSPHSQSSNPSSRDSSPSRDFLPAL 1036
>TGT_ANASP (Q8YVT9) Queuine tRNA-ribosyltransferase (EC 2.4.2.29)| (tRNA-guanine transglycosylase) (Guanine insertion enzyme) Length = 374 Score = 28.1 bits (61), Expect = 9.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 59 RWVENGDALVRGERW 15 RW +G A+V+GERW Sbjct: 274 RWARHGTAMVKGERW 288
>MAST2_HUMAN (Q6P0Q8) Microtubule-associated serine/threonine-protein kinase 2 (EC| 2.7.11.1) Length = 1798 Score = 28.1 bits (61), Expect = 9.4 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 1 LPSTHHL-SPLTRASPFSTHRTTSIAKVRASQPQRS*LARL 120 +PS HH SPL ASP S H +S R S P R L L Sbjct: 1060 IPSEHHTCSPL--ASPMSPHSQSSNPSSRDSSPSRDFLPAL 1098 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,389,343 Number of Sequences: 219361 Number of extensions: 503291 Number of successful extensions: 1967 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1967 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)