| Clone Name | bast62d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1... | 30 | 1.6 | 2 | SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1 | 30 | 1.6 | 3 | BUD8_YEAST (P41698) Bud site selection protein BUD8 | 29 | 3.6 | 4 | POL1_GFLV (P29149) RNA1 polyprotein (P1) [Contains: P1A protein ... | 28 | 8.0 |
|---|
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 30.0 bits (66), Expect = 1.6 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 2 PPKHRRHSPPLAHPRAASL*LPPREIXXXXXXXXARSHPSTTRSQPA 142 PPK R SPP R AS PP+ RS P T R P+ Sbjct: 609 PPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPS 655
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 30.0 bits (66), Expect = 1.6 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 2 PPKHRRHSPPLAHPRAASL*LPPREIXXXXXXXXARSHPSTTRSQPA 142 PPK R SPP R AS PP+ RS P T R P+ Sbjct: 623 PPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPS 669
>BUD8_YEAST (P41698) Bud site selection protein BUD8| Length = 603 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Frame = +3 Query: 9 SIAATLRLSLIRVQHLSSSPLERSHSRVSSS------KQGHIPAPPGANPR 143 S A T+ S++ + + SP+E+ HSRV SS +G+ + G PR Sbjct: 154 SCALTISTSVLMGEDVEGSPIEQEHSRVVSSLYSSLANRGNDESKNGTPPR 204
>POL1_GFLV (P29149) RNA1 polyprotein (P1) [Contains: P1A protein (1A) (Protease| cofactor); Putative ATP-dependent helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (1B) (Membrane-binding protein); Viral genome-linked protein (1C-VPg); Picornain 3C-like pr Length = 2284 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 36 LIRVQHLSSSPLERSHSRVSSSKQGHIPAPPGANP-RRQW 152 L+RV+ LS SR+ K+GH+P G NP R+W Sbjct: 1684 LLRVKFLS-------FSRLLMKKRGHLPCQVGINPYSREW 1716 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,512,729 Number of Sequences: 219361 Number of extensions: 286162 Number of successful extensions: 1234 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1234 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)