| Clone Name | bast62a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ILVE_STRCO (O86505) Probable branched-chain-amino-acid aminotran... | 28 | 4.4 | 2 | FBRL_DEBHA (Q6BQ34) Fibrillarin | 27 | 9.8 | 3 | Y1014_TREPA (O83978) Hypothetical protein TP1014 | 27 | 9.8 |
|---|
>ILVE_STRCO (O86505) Probable branched-chain-amino-acid aminotransferase (EC| 2.6.1.42) (BCAT) Length = 362 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +3 Query: 84 SSPTVAYHPS---PISCSLSSDHERSRGGGLRRACSDGNLAA 200 +SP AY P P+S +S D R+ GG+ A + GN AA Sbjct: 168 ASPAGAYFPGGVKPVSIWVSEDRVRAVPGGMGDAKTGGNYAA 209
>FBRL_DEBHA (Q6BQ34) Fibrillarin| Length = 329 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 171 GAGRPRESARGRRTGCRRWATGGTR 97 G G PR ARG R G R A GG + Sbjct: 63 GRGGPRGGARGGRGGARGGARGGAK 87
>Y1014_TREPA (O83978) Hypothetical protein TP1014| Length = 644 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 72 HFAESSPTVAYHPSPISCSLSSDHERSRGGGLRRACSDGNLAAL 203 H ESS ++ + S S+ R+ G+RR+ DG LAAL Sbjct: 71 HARESSQYLSIAKRQMELSASAAALRTLQRGIRRSADDGRLAAL 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,818,261 Number of Sequences: 219361 Number of extensions: 197650 Number of successful extensions: 790 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)