| Clone Name | bast62a01 |
|---|---|
| Clone Library Name | barley_pub |
>GID2_ORYSA (Q7XAK4) F-box protein GID2 (Gibberellin-insensitive dwarf protein| 2) (Protein GIBBERELLIN INSENSITIVE DWARF2) Length = 212 Score = 32.0 bits (71), Expect = 0.74 Identities = 20/50 (40%), Positives = 26/50 (52%) Frame = +3 Query: 144 VGPDLSACVFARLHDPADLARAATVSRPWRRFVEGNGFLKKACVRKFPEL 293 +G DL V R + LA AA VSR WR+ E + ACVR++ L Sbjct: 76 LGEDLVFEVLRRA-EARTLAAAACVSRGWRQLAEDERLWEAACVREWANL 124
>FBXW7_DROME (Q9VZF4) F-box/WD-repeat protein 7 (F-box and WD-40 domain protein 7)| (Protein archipelago) Length = 1326 Score = 30.4 bits (67), Expect = 2.2 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 132 FLDLVGPDLSACVFARLHDPADLARAATVSRPWRRFVEGNGFLKKAC 272 F+ L+ +L+ V + L +P DL RAA R WR + N K+ C Sbjct: 891 FISLLPRELALFVLSYL-EPKDLLRAAQTCRSWRFLCDDNLLWKEKC 936
>PHLPP_DROME (Q9VJ07) Protein phosphatase PHLPP-like protein (EC 3.1.3.16)| (dPHLPP) Length = 954 Score = 30.0 bits (66), Expect = 2.8 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +3 Query: 105 KQQQGDPAAF--LDLVGPDLSACVFARLHDPADLARAATVSRPWRRFVEGNGFLKKACVR 278 + +Q + AA L L G L+ +F LH+ A L + + R G L ACVR Sbjct: 247 RYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLR---VLHLAYNRI----GVLPAACVR 299 Query: 279 KFPELAVL 302 +PEL +L Sbjct: 300 NWPELEIL 307
>FBXW7_HUMAN (Q969H0) F-box/WD-repeat protein 7 (F-box and WD-40 domain protein| 7) (F-box protein FBX30) (hCdc4) (Archipelago homolog) (hAgo) (SEL-10) Length = 707 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 132 FLDLVGPDLSACVFARLHDPADLARAATVSRPWRRFVEGNGFLKKAC 272 F+ L+ +L+ V + L +P DL +AA R WR E N ++ C Sbjct: 280 FISLLPKELALYVLSFL-EPKDLLQAAQTCRYWRILAEDNLLWREKC 325
>FBXW7_MOUSE (Q8VBV4) F-box/WD-repeat protein 7 (F-box and WD-40 domain protein| 7) (F-box protein FBW7) (F-box protein Fbxw6) (F-box-WD40 repeat protein 6) (SEL-10) Length = 629 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 132 FLDLVGPDLSACVFARLHDPADLARAATVSRPWRRFVEGNGFLKKAC 272 F+ L+ +L+ V + L +P DL +AA R WR E N ++ C Sbjct: 202 FISLLPKELALYVLSFL-EPKDLLQAAQTCRYWRILAEDNLLWREKC 247
>FBX17_HUMAN (Q96EF6) F-box only protein 17 (F-box only protein 26)| Length = 278 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 120 DPAAFLDLVGPDLSACVFARLHDPADLARAATVSRPWRRFVEG 248 DP+ LD + P+L V + + + + R V R WR V+G Sbjct: 13 DPSLALDALPPELLVQVLSHVPPRSLVTRCRPVCRAWRDIVDG 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.128 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,538,196 Number of Sequences: 219361 Number of extensions: 475793 Number of successful extensions: 761 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)