| Clone Name | bast61g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CT112_MOUSE (Q6DIB4) Protein C20orf112 homolog | 29 | 2.3 | 2 | PCD15_MOUSE (Q99PJ1) Protocadherin-15 precursor | 28 | 5.2 | 3 | RGS14_MOUSE (P97492) Regulator of G-protein signaling 14 (RGS14)... | 28 | 6.8 |
|---|
>CT112_MOUSE (Q6DIB4) Protein C20orf112 homolog| Length = 494 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +3 Query: 3 TTPHPPSPSLAAQTTARTLPSRSCSSQLVTKCR 101 +TP PP+P+ ++ +T+RT+P+ S ++ R Sbjct: 434 STPTPPTPTPSSNSTSRTMPTAQLSPTEISAVR 466
>PCD15_MOUSE (Q99PJ1) Protocadherin-15 precursor| Length = 1943 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 9 PHPPSPSLAAQTTARTLPSRSCSSQLVTKCRSSGCWPR 122 P PP+P L Q + ++PS S KC +S R Sbjct: 1807 PRPPAPRLFPQPPSTSIPSTDSISAPAAKCTASATHAR 1844
>RGS14_MOUSE (P97492) Regulator of G-protein signaling 14 (RGS14)| (RAP1/RAP2-interacting protein) Length = 547 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +3 Query: 18 PSPSLAAQTTARTLP--SRSCSSQLVTKCRSSGCWPR 122 P S+A+QT P ++ ++ ++ CRS GC PR Sbjct: 432 PVSSVASQTLVLDTPPDAKMSEARSISPCRSQGCLPR 468 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,460,977 Number of Sequences: 219361 Number of extensions: 298313 Number of successful extensions: 1310 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)