| Clone Name | bast61f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ILV5_SPIOL (Q01292) Ketol-acid reductoisomerase, chloroplast pre... | 92 | 4e-19 | 2 | ILV5_PEA (O82043) Ketol-acid reductoisomerase, chloroplast precu... | 91 | 1e-18 | 3 | ILV5_ARATH (Q05758) Ketol-acid reductoisomerase, chloroplast pre... | 89 | 6e-18 | 4 | LRP1_HHV1F (P17588) Latency-related protein 1 | 28 | 7.4 |
|---|
>ILV5_SPIOL (Q01292) Ketol-acid reductoisomerase, chloroplast precursor (EC| 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 595 Score = 92.4 bits (228), Expect = 4e-19 Identities = 40/51 (78%), Positives = 49/51 (96%) Frame = +2 Query: 281 SLDFDTAVFNKEKVSLAGHEEHIVRGGRNLFPLLPEAFKGVKQIGVIGWGS 433 + DFD++VF KEKV+L+GH+E+IVRGGRNLFPLLP+AFKG+KQIGVIGWGS Sbjct: 85 TFDFDSSVFKKEKVTLSGHDEYIVRGGRNLFPLLPDAFKGIKQIGVIGWGS 135
>ILV5_PEA (O82043) Ketol-acid reductoisomerase, chloroplast precursor (EC| 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 581 Score = 90.9 bits (224), Expect = 1e-18 Identities = 41/51 (80%), Positives = 49/51 (96%) Frame = +2 Query: 281 SLDFDTAVFNKEKVSLAGHEEHIVRGGRNLFPLLPEAFKGVKQIGVIGWGS 433 SLDF+T+VF KE+V+LAGHEE+IVRGGR+LF LLP+AFKG+KQIGVIGWGS Sbjct: 69 SLDFETSVFKKERVNLAGHEEYIVRGGRDLFHLLPDAFKGIKQIGVIGWGS 119
>ILV5_ARATH (Q05758) Ketol-acid reductoisomerase, chloroplast precursor (EC| 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 591 Score = 88.6 bits (218), Expect = 6e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +2 Query: 281 SLDFDTAVFNKEKVSLAGHEEHIVRGGRNLFPLLPEAFKGVKQIGVIGWGS 433 SLDF+T+VF KEKVSLAG+EE+IVRGGR+LF LP+AFKG+KQIGVIGWGS Sbjct: 79 SLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGIKQIGVIGWGS 129
>LRP1_HHV1F (P17588) Latency-related protein 1| Length = 340 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 322 LPRRPRGAHRQGRAEPLPAAP 384 LPR P +H RA PLP AP Sbjct: 39 LPRTPTPSHPHSRAPPLPRAP 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,317,776 Number of Sequences: 219361 Number of extensions: 297999 Number of successful extensions: 1172 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1172 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)