| Clone Name | bast61d07 |
|---|---|
| Clone Library Name | barley_pub |
>ASPP2_HUMAN (Q13625) Apoptosis-stimulating of p53 protein 2 (Tumor suppressor| p53-binding protein 2) (p53-binding protein 2) (p53BP2) (53BP2) (Bcl2-binding protein) (Bbp) (NY-REN-51 antigen) Length = 1128 Score = 31.6 bits (70), Expect = 1.0 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 1 LQTLLPSTATKAVPGARQPRDLTSPSSKAPG 93 L T++PS TK P +QPR L SPS + G Sbjct: 533 LSTVVPSMGTKPKPAGQQPRVLLSPSIPSVG 563
>PLK2_HUMAN (Q9NYY3) Serine/threonine-protein kinase PLK2 (EC 2.7.11.21)| (Polo-like kinase 1) (PLK-2) (Serine/threonine-protein kinase SNK) (Serum-inducible kinase) Length = 685 Score = 30.8 bits (68), Expect = 1.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 2 SKLSFPPQPQKPSLELASQETSPHLAPRHQAHH 100 SK PPQP + S SQ P AP H HH Sbjct: 30 SKKKRPPQPPEESQPPQSQAQVPPAAPHHHHHH 62
>TOP1_BACSU (P39814) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 691 Score = 28.9 bits (63), Expect = 6.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 348 ILDKLDGYELAPASWSEVSKAL 413 ILD+L GY+++P W +V K L Sbjct: 141 ILDRLVGYKISPILWKKVKKGL 162
>MAGI2_HUMAN (Q86UL8) Membrane-associated guanylate kinase, WW and PDZ| domain-containing protein 2 (Membrane-associated guanylate kinase inverted 2) (MAGI-2) (Atrophin-1-interacting protein 1) (Atrophin-1-interacting protein A) Length = 1455 Score = 28.9 bits (63), Expect = 6.7 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +1 Query: 10 LLPSTATKAVPGARQPRDLTSPSSKAPGAPWVARALRKWRWQRLPTALRPPASP 171 LL T VP +P +SP++ APG P V +L P+ PP+ P Sbjct: 1223 LLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDDGLAPFSPSHPAPPSDP 1276
>PAP3_ORYSA (Q7XBW5) Probable plastid-lipid associated protein 3, chloroplast| precursor Length = 374 Score = 28.9 bits (63), Expect = 6.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 10 LLPSTATKAVPGARQPRDLTSPSSKAPGAPWVARALRKWRW-QRLPTALRPPASP 171 LLPS + G+R+P L SS+ P A + W R P+A PP+ P Sbjct: 17 LLPSPTIHSSTGSRRPFRLPLRSSRRPPVAAAAASGVPDEWGDRSPSAPEPPSQP 71
>G6PD_SYNY3 (P73411) Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49) (G6PD)| Length = 509 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 31 KAVPGARQPRDLTSPSSKAPGAPWVARALRKWRWQRLPTALR 156 K VPG R+ + PSS P + + WRWQ +P LR Sbjct: 316 KPVPGYREEPGV-DPSSTTPTFAALKLMVDNWRWQGVPFYLR 356
>SPTB1_MOUSE (P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin)| Length = 2127 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 348 ILDKLDGYELAPASWSEVSKALEDIKP-TLDSKQRRTP 458 ++ + + +E + ASW+E ALE KP TL+ K+R+TP Sbjct: 2037 LIKRHEAFEKSTASWAERFAALE--KPTTLELKERQTP 2072 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.127 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,460,315 Number of Sequences: 219361 Number of extensions: 742563 Number of successful extensions: 2386 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2384 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)