| Clone Name | bast60g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 6PGL_DROME (Q9VZ64) Putative 6-phosphogluconolactonase (EC 3.1.1... | 34 | 0.18 | 2 | 6PGL_MOUSE (Q9CQ60) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL) | 32 | 0.70 | 3 | SOL3_YEAST (P38858) Probable 6-phosphogluconolactonase 3 (EC 3.1... | 30 | 2.0 | 4 | 6PGL_HUMAN (O95336) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL) | 28 | 7.7 |
|---|
>6PGL_DROME (Q9VZ64) Putative 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 243 Score = 33.9 bits (76), Expect = 0.18 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +2 Query: 266 AEENLAVSLAKYTADLSAKFAAERGAFTVVLSGGSLIHALRKLTEAPYLQTVDW 427 +EE L +L S + A+ F+V LSGGSL+ L K ++ L+T W Sbjct: 15 SEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGSLVQLLTKALKSCNLKTAKW 68
>6PGL_MOUSE (Q9CQ60) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 257 Score = 32.0 bits (71), Expect = 0.70 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 257 IFDAEENLAVSLAKYTADLSAK-FAAERGAFTVVLSGGSLIHALRK 391 +F + + L SLA+ A +A +RG F + LSGGSL+ L + Sbjct: 11 VFSSPQELGASLAQLVAQRAASCLEGDRGRFALGLSGGSLVSMLAR 56
>SOL3_YEAST (P38858) Probable 6-phosphogluconolactonase 3 (EC 3.1.1.31) (6PGL)| Length = 280 Score = 30.4 bits (67), Expect = 2.0 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +2 Query: 257 IFDAEENLAVSLAKYTADLSAKFAAERGAFTVVLSGGSLIHALRK--LTEAPYLQTVDWT 430 +F +L L ++ + ++ F V +SGGSLI AL + + + V W+ Sbjct: 37 VFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSSRVQWS 96 Query: 431 KW 436 KW Sbjct: 97 KW 98
>6PGL_HUMAN (O95336) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 258 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 257 IFDAEENLAVSLAKYTADLSAK-FAAERGAFTVVLSGGSLIHALRK 391 +F + + L +LA+ A +A A R F + LSGGSL+ L + Sbjct: 11 VFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLAR 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,917,663 Number of Sequences: 219361 Number of extensions: 340617 Number of successful extensions: 1206 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1206 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)