| Clone Name | bast60g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EMBB_MYCAV (P71486) Probable arabinosyltransferase B (EC 2.4.2.-) | 29 | 3.1 | 2 | QA1S_NEUCR (P11637) Quinate repressor | 28 | 6.8 | 3 | DUS8_MOUSE (O09112) Dual specificity protein phosphatase 8 (EC 3... | 28 | 6.8 | 4 | CYST_SYNY3 (Q01895) Sulfate transport system permease protein cysT | 27 | 8.9 |
|---|
>EMBB_MYCAV (P71486) Probable arabinosyltransferase B (EC 2.4.2.-)| Length = 1065 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 155 LQYYCVFAAVGVAVIVLSLTFLSPSAMGAVRQNLGTVVAV 274 + ++ +FAAVG A+ L+ +SP+ +G R + + A+ Sbjct: 562 VHHFGLFAAVGAAMAALTTVLVSPAVLGWSRNRMAFLAAL 601
>QA1S_NEUCR (P11637) Quinate repressor| Length = 919 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 325 SASYDPRYSIASAGIRGHGHDGAEVLA 245 +AS+DP SI AGIRG G ++A Sbjct: 96 TASFDPDASIVIAGIRGAGKSTLAIMA 122
>DUS8_MOUSE (O09112) Dual specificity protein phosphatase 8 (EC 3.1.3.48) (EC| 3.1.3.16) (Neuronal tyrosine threonine phosphatase 1) Length = 663 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 13 LRARALRETWPREGASKREKPRRSCK 90 LR R +R WP E A+ + RRSC+ Sbjct: 602 LRRRDVRTGWPEEPAADAQFKRRSCQ 627
>CYST_SYNY3 (Q01895) Sulfate transport system permease protein cysT| Length = 286 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 146 SLRLQYYCVFAAVGVAVIVLSLTFLSPSAMGAVRQNLGTVVA 271 SL L+ + A +A+ ++TF++ A G V +GT+VA Sbjct: 51 SLGLEGFWQIATTPIAISTYNVTFITALAAGLVNGVMGTLVA 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,171,514 Number of Sequences: 219361 Number of extensions: 271104 Number of successful extensions: 1049 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)