| Clone Name | bast60e07 |
|---|---|
| Clone Library Name | barley_pub |
>GYRB_MYXXA (O33367) DNA gyrase subunit B (EC 5.99.1.3)| Length = 815 Score = 32.0 bits (71), Expect = 0.61 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -1 Query: 229 WCSTPAPAPGQWCA-PAAIGILGGSCAITYG-RERTSW 122 WC TP+ P WC+ P + G C+ T R R++W Sbjct: 662 WCRTPSTTPRSWCSTPTRMEPCGRRCSTTPSCRRRSTW 699
>PYGO_DROME (Q9V9W8) Protein pygopus (Protein gammy legs)| Length = 815 Score = 31.6 bits (70), Expect = 0.80 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 248 HGGPVAMVLHAGSGAGPVVRPGSHRDLGRELRH 150 HGGP M H G G P + G H + G + H Sbjct: 607 HGGPAGMPPHMGGGPNPHMMGGPHGNAGPHMGH 639
>MTP7_PSEAE (P05103) Modification methylase PaeR7I (EC 2.1.1.72)| (Adenine-specific methyltransferase PaeR7I) (M.PaeR7I) Length = 549 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +2 Query: 20 AHRSHYAARWLVTLSG*LALPELARSY*LLRIAGPARPLSTVRNGA 157 AHR L TL+G L+ P L + AGP R L+ V NGA Sbjct: 249 AHRPSIDRATLTTLAGLLSAPTLPKD------AGPVRELARVTNGA 288
>ODP2_RALEU (Q59098) Dihydrolipoyllysine-residue acetyltransferase component of| pyruvate dehydrogenase complex (EC 2.3.1.12) (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) Length = 553 Score = 29.6 bits (65), Expect = 3.0 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 244 AGPWPWCSTPAPAPGQWCAPAAIGILGGSCAI 149 A P P + PAPAP APAA GG I Sbjct: 92 AAPAPAAAAPAPAPAPAAAPAAAPAAGGGGTI 123
>FAT2_RAT (O88277) Protocadherin Fat 2 precursor (Multiple epidermal growth| factor-like domains 1) Length = 4351 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 226 CSTPAPAPGQWCAPAAIGILGGSCAITYGRERTSW 122 C+ P P G C A G GG C IT +R W Sbjct: 4012 CNCPHPYTGDRCEMEARGCSGGHCLITPEIKRGDW 4046
>IRX5_HUMAN (P78411) Iroquois-class homeodomain protein IRX-5 (Iroquois| homeobox protein 5) (Homeodomain protein IRXB2) (IRX-2A) Length = 482 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -3 Query: 221 HAGSGAGPVVRPGSHRDLGRELRHYVRSRADELAR 117 H G G GP PGSH + L V +RAD LA+ Sbjct: 423 HPGPGPGPTTGPGSHFN---GLNQTVLNRADALAK 454
>BLVR_BOVIN (Q03368) Bovine leukemia virus cell receptor precursor (BLV-R)| (BLVPCP1) Length = 843 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -1 Query: 241 GPWPWCSTPAPAPGQWCAPAAIGILGG-----SCAITYGR 137 GP PW PA G+W A+ +L C T GR Sbjct: 744 GPGPWPPCPAACCGEWWRATALALLSSLDALQVCVCTCGR 783
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -1 Query: 232 PWCSTPAPAPGQWCAPAAIG----ILGGSCAITYGRERTS 125 P CS P P P C ++ G GG C +++ R R S Sbjct: 38 PQCSAPCPPPVSSCCGSSSGGCCSSEGGGCCLSHHRPRQS 77
>MAML1_HUMAN (Q92585) Mastermind-like protein 1 (Mam-1)| Length = 1016 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 232 PWCSTPAPAPGQWCAPAAIGILGGSCAITYGRERTSWPGNAQQ 104 P +TPAPAPGQ G S + Y E+ + P + +Q Sbjct: 415 PQQATPAPAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQ 457 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.127 0.446 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,423,908 Number of Sequences: 219361 Number of extensions: 670985 Number of successful extensions: 2696 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2690 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)