| Clone Name | bast60c05 |
|---|---|
| Clone Library Name | barley_pub |
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 32.7 bits (73), Expect = 0.53 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 12/70 (17%) Frame = +3 Query: 9 PASGPD*LPHR-PA-----GGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRH------PR 152 P GP PH P+ GG P Q +G PP + PPP + G H H + Sbjct: 390 PGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQ 449 Query: 153 RSLSTPAGTG 182 STP G+G Sbjct: 450 YLGSTPVGSG 459
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 32.7 bits (73), Expect = 0.53 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 12/70 (17%) Frame = +3 Query: 9 PASGPD*LPHR-PA-----GGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRH------PR 152 P GP PH P+ GG P Q +G PP + PPP + G H H + Sbjct: 390 PGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQ 449 Query: 153 RSLSTPAGTG 182 STP G+G Sbjct: 450 YLGSTPVGSG 459
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 31.6 bits (70), Expect = 1.2 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 33 PHRPAGGSPDQPTASGRSPPH-LHPPPAQLI*GIHQWRHPRRSLSTPAGTGPP 188 P RP +P S PPH HPPP Q H HP T A PP Sbjct: 395 PQRPQHPAPHPQQHSQLQPPHSQHPPPHQ-----HIQHHPNHQHQTLAHQPPP 442
>PRP_PIG (Q95JC9) Basic proline-rich protein precursor [Contains:| Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] Length = 676 Score = 31.2 bits (69), Expect = 1.6 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +3 Query: 33 PHRPAGGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRHPRRSLSTPAGTGPPG 191 P PAG P P + G +PP PPP P P G PPG Sbjct: 441 PPPPAGPPPPGPPSPGPAPPGARPPPG-----------PPPPGPPPPGPAPPG 482 Score = 28.9 bits (63), Expect = 7.7 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +3 Query: 9 PASGPD*LPHRPAGGSPDQPTASGRSPPHLHPPPAQ--LI*GIHQWRHPRRSLSTPAGTG 182 P GP P G P P G PP PPPA P++ PAG Sbjct: 394 PPPGPP-----PPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPP 448 Query: 183 PPG 191 PPG Sbjct: 449 PPG 451
>SAM68_MOUSE (Q60749) KH domain-containing, RNA-binding, signal| transduction-associated protein 1 (p21 Ras GTPase-activating protein-associated p62) (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p68) Length = 443 Score = 30.8 bits (68), Expect = 2.0 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 15 SGPD*LPHRPAGGSPDQPTASGRSPPHLHPPP 110 S P LPHRP GG P R+ P PPP Sbjct: 35 SRPSPLPHRPRGGG-GGPRGGARASPATQPPP 65
>SMRC1_MOUSE (P97496) SWI/SNF-related matrix-associated actin-dependent regulator| of chromatin subfamily C member 1 (SWI/SNF complex 155 kDa subunit) (BRG1-associated factor 155) (SWI3-related protein) Length = 1104 Score = 30.4 bits (67), Expect = 2.7 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 42 PAGGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRHPRRSLSTPAGTGPP 188 PA + PT SG +PP + P P ++ PR L+ P G PP Sbjct: 1035 PAVAANIHPTGSGPTPPGMPPMPGNIL-------GPRVPLTAPNGMYPP 1076
>WASP_MOUSE (P70315) Wiskott-Aldrich syndrome protein homolog (WASp)| Length = 520 Score = 30.4 bits (67), Expect = 2.7 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 15 SGPD*LPHRPAGGSPDQPTASGRSPPHLHPPP 110 SGP LP P GG+P PT G PP PP Sbjct: 356 SGP--LPPVPMGGAPPPPTPRGPPPPGRGGPP 385
>BRO1_NEUCR (Q7SAN9) Vacuolar protein-sorting protein bro-1 (BRO| domain-containing protein 1) Length = 1012 Score = 30.0 bits (66), Expect = 3.5 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Frame = +3 Query: 9 PASGP-D*LPHRPAGG--SPDQ---PTASGRSPPHLHPPPAQLI*GIHQWRHP 149 PAS P +PH P G +P Q P++ GR P PPP Q I RHP Sbjct: 833 PASPPATQVPHNPGGQQQTPYQQYNPSSLGRIPGPASPPPNQTSFNIGPGRHP 885
>MTF1_MOUSE (Q07243) Metal-regulatory transcription factor 1 (Transcription| factor MTF-1) (MRE-binding transcription factor) Length = 675 Score = 29.6 bits (65), Expect = 4.5 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 3 LAPASGPD*LPHRPAGGSPDQPTASGRSPPHLHPP 107 L PA+ P P P+ G QP A G P L PP Sbjct: 433 LLPATAPSAPPPAPSLGPGSQPAAFGSPPALLQPP 467
>BAI1_HUMAN (O14514) Brain-specific angiogenesis inhibitor 1 precursor| Length = 1584 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 9 PASGPD*LPHR--PAGGSPDQPTASGRSPPHLHPPPAQ 116 PA P P R P+GG P+ P A PP PPP Q Sbjct: 1389 PARSP---PSRQPPSGGPPEAPPAQPPPPPPPPPPPPQ 1423
>BRM_DROME (P25439) Homeotic gene regulator (EC 3.6.1.-) (ATP-dependent| helicase brm) (Protein brahma) Length = 1638 Score = 29.6 bits (65), Expect = 4.5 Identities = 25/71 (35%), Positives = 29/71 (40%), Gaps = 7/71 (9%) Frame = +3 Query: 6 APASGPD*LPHRPAGGSP--DQPTASGRSP-PHLHPPPAQLI*GIHQWRHP----RRSLS 164 +PA+ P P P+ +P P S SP PH P P Q G HP Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQ---GPPPPGHPGAYGHPMQH 61 Query: 165 TPAGTGPPGWH 197 P G GPPG H Sbjct: 62 GPPGQGPPGHH 72
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 30 LPHRPAGGSPDQPTASGRSPPHLHP-PPAQLI*GIHQWRHP 149 L H P+G P TA G P + P PP+Q+I RHP Sbjct: 448 LAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHP 488
>HCN4_RABIT (Q9TV66) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Hyperpolarization-activated cation channel 4) (HAC-4) Length = 1175 Score = 29.3 bits (64), Expect = 5.9 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 7/70 (10%) Frame = +3 Query: 3 LAPASGPD*LPHRPAGGSPDQPTASGRSPP------HLHPPPAQL-I*GIHQWRHPRRSL 161 L+ + P P + A SP QP +P H PPPA+ Q P L Sbjct: 904 LSSSDSPLLTPMQSAARSPQQPPPPPGAPAGLGLLEHFLPPPARSPTSSPGQLGQPPGEL 963 Query: 162 STPAGTGPPG 191 S G+GPPG Sbjct: 964 SPGLGSGPPG 973
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 29.3 bits (64), Expect = 5.9 Identities = 22/65 (33%), Positives = 26/65 (40%), Gaps = 5/65 (7%) Frame = +3 Query: 9 PASGPD*LPHRPAGGSPDQPTASGRSPPHLHPP-----PAQLI*GIHQWRHPRRSLSTPA 173 P GP P +GG+ G PH PP AQ G HQ +HP+ P Sbjct: 1233 PGQGPG--PGAASGGAGAVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQH--QHPG 1288 Query: 174 GTGPP 188 GPP Sbjct: 1289 LPGPP 1293
>DLX2A_BRARE (P50574) Homeobox protein Dlx2a (DLX-2) (Distal-less homeobox gene| 2a) Length = 270 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 57 PDQPTASGRSPPHLHPPPA 113 P+Q ASG SPPH PP A Sbjct: 189 PEQHVASGESPPHPSPPLA 207
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 28.9 bits (63), Expect = 7.7 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 30 LPHRPAGGSPDQPTASGRSPPHLHP-PPAQLI*GIHQWRHP 149 L H P+G P TA G P + P PP+Q++ RHP Sbjct: 448 LAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLPASEPKRHP 488 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,709,106 Number of Sequences: 219361 Number of extensions: 1186650 Number of successful extensions: 4183 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4088 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)