| Clone Name | bast59f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLA7_ARATH (Q9SJ81) Fasciclin-like arabinogalactan protein 7 pre... | 36 | 0.027 | 2 | FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 pre... | 32 | 0.29 | 3 | FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 p... | 31 | 0.85 | 4 | PSPA_SHIFL (P0AFM8) Phage shock protein A | 28 | 5.5 | 5 | PSPA_ECOLI (P0AFM6) Phage shock protein A | 28 | 5.5 | 6 | PSPA_ECO57 (P0AFM7) Phage shock protein A | 28 | 5.5 | 7 | PALB_CANGA (Q6FJ28) Calpain-like protease palB/RIM13 (EC 3.4.22.... | 27 | 9.4 |
|---|
>FLA7_ARATH (Q9SJ81) Fasciclin-like arabinogalactan protein 7 precursor| Length = 254 Score = 35.8 bits (81), Expect = 0.027 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 212 NVTAVLEKAGQYTKFIRLMASTQQDTQLNAQANESDTGFTVFAPTDNA 355 N+T +L AG + F+ + ST QAN ++ G T+F P D+A Sbjct: 46 NLTELLSVAGPFHTFLDYLLSTGVIETFQNQANNTEEGITIFVPKDDA 93
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 32.3 bits (72), Expect = 0.29 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +2 Query: 200 AAAPNVTAVLEKAGQYTKFIRLMASTQQDTQLNAQANESDTGFTVFAPTDNA 355 A+ N+T +LEKAG T F L+ S+ L + + G TVFAP+D A Sbjct: 185 ASLSNITGLLEKAGCKT-FANLLVSSGV---LKTYESAVEKGLTVFAPSDEA 232
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 30.8 bits (68), Expect = 0.85 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +2 Query: 200 AAAPNVTAVLEKAGQYTKFIRLMASTQQDTQLNAQANESDTGFTVFAPTDNA 355 A N+T +LEKAG T F L+ S+ + + + G TVFAP+D A Sbjct: 186 AGVSNITGLLEKAGCKT-FANLLVSSGV---IKTFESTVEKGLTVFAPSDEA 233
>PSPA_SHIFL (P0AFM8) Phage shock protein A| Length = 221 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 212 NVTAVLEKAGQYTKFIRLMASTQQDTQLNAQANES 316 N+ A+LEKA K +RLM +DT + ++ + Sbjct: 13 NINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSA 47
>PSPA_ECOLI (P0AFM6) Phage shock protein A| Length = 221 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 212 NVTAVLEKAGQYTKFIRLMASTQQDTQLNAQANES 316 N+ A+LEKA K +RLM +DT + ++ + Sbjct: 13 NINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSA 47
>PSPA_ECO57 (P0AFM7) Phage shock protein A| Length = 221 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 212 NVTAVLEKAGQYTKFIRLMASTQQDTQLNAQANES 316 N+ A+LEKA K +RLM +DT + ++ + Sbjct: 13 NINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSA 47
>PALB_CANGA (Q6FJ28) Calpain-like protease palB/RIM13 (EC 3.4.22.-) (Cysteine| protease RIM13) Length = 713 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 203 AAPNVTAV-LEKAGQYTK-FIRLMASTQQDTQLNAQANESDTGFTVFAPTDN 352 A+ +T + L +Y K F+R+ TQ+D + N + +DTG + P +N Sbjct: 610 ASTGITKISLVNRNKYNKVFMRIYPQTQEDYRYNYRVISADTGEDLVKPGNN 661 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,966,300 Number of Sequences: 219361 Number of extensions: 232383 Number of successful extensions: 793 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)