| Clone Name | bast59e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | C1QT5_HUMAN (Q9BXJ0) Complement C1q tumor necrosis factor-relate... | 28 | 8.4 |
|---|
>C1QT5_HUMAN (Q9BXJ0) Complement C1q tumor necrosis factor-related protein 5| precursor Length = 243 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 332 PSGMLVQKRTPDSDPPPGGAPVPTIRVKVKYAGVYHEV 445 P KR+ PPP AP+P RV V G Y V Sbjct: 102 PRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAV 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,793,685 Number of Sequences: 219361 Number of extensions: 598641 Number of successful extensions: 1777 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1774 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)