| Clone Name | bast59c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SP15_STRGR (P19471) 55.5 kDa and 49.5 kDa sporulation proteins (... | 29 | 6.0 | 2 | HSF24_LYCPE (P22335) Heat shock factor protein HSF24 (Heat shock... | 29 | 6.0 | 3 | KCNQ1_HUMAN (P51787) Potassium voltage-gated channel subfamily K... | 28 | 7.9 | 4 | CD4_RABIT (P46630) T-cell surface glycoprotein CD4 precursor (T-... | 28 | 7.9 |
|---|
>SP15_STRGR (P19471) 55.5 kDa and 49.5 kDa sporulation proteins (ORF1590 and| ORF1422) Length = 529 Score = 28.9 bits (63), Expect = 6.0 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 97 EQERAIDPPVQSARSVKAAASFPAGAWVLVLGFLTASSKGF 219 +QE A +Q+ R +AAA P G +VL L A+ +GF Sbjct: 303 QQEAAQRYYIQALRLARAAADVPLGGYVLASMSLQATYRGF 343
>HSF24_LYCPE (P22335) Heat shock factor protein HSF24 (Heat shock transcription| factor 24) (HSTF 24) (Heat stress transcription factor) Length = 301 Score = 28.9 bits (63), Expect = 6.0 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 7/63 (11%) Frame = -1 Query: 260 RRVAPHRGEF-----DAGQNPFEDAVRKPKTSTQAPAGKE--AAALTDRAD*TGGSIARS 102 R++ P + EF GQ A+R+ KT T PAG + AA + D +G I S Sbjct: 71 RKIVPDKWEFANENFKRGQKELLTAIRRRKTVTSTPAGGKSVAAGASASPDNSGDDIGSS 130 Query: 101 CSA 93 ++ Sbjct: 131 STS 133
>KCNQ1_HUMAN (P51787) Potassium voltage-gated channel subfamily KQT member 1| (Voltage-gated potassium channel subunit Kv7.1) (IKs producing slow voltage-gated potassium channel alpha subunit KvLQT1) (KQT-like 1) Length = 676 Score = 28.5 bits (62), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 174 GPSRKGGCSLNRPSGLNGRIDRSLLL 97 GP R+GG + +P G G +D L L Sbjct: 629 GPPREGGAHITQPCGSGGSVDPELFL 654
>CD4_RABIT (P46630) T-cell surface glycoprotein CD4 precursor (T-cell surface| antigen T4/Leu-3) Length = 459 Score = 28.5 bits (62), Expect = 7.9 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 91 RAEQERAIDPPVQSARSVKAAASFPAGAWVLVLGFLTASSKGFWPASNSPL 243 R + ++ P QS++ + ++ V +LG +SS FW NSPL Sbjct: 30 RGKAGAIVELPCQSSQKRNSVFNWKHANQVKILGNQGSSSSSFWLKGNSPL 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,740,385 Number of Sequences: 219361 Number of extensions: 762859 Number of successful extensions: 2604 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2599 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)