| Clone Name | bast59b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MEN1_HUMAN (O00255) Menin | 28 | 5.3 | 2 | TLE2_HUMAN (Q04725) Transducin-like enhancer protein 2 (ESG2) | 28 | 7.0 | 3 | POLN_HEVPA (P33424) Non-structural polyprotein (EC 2.7.7.48) (RN... | 28 | 7.0 | 4 | NID2_HUMAN (Q14112) Nidogen-2 precursor (NID-2) (Osteonidogen) | 27 | 9.1 |
|---|
>MEN1_HUMAN (O00255) Menin| Length = 615 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = -2 Query: 209 PPRPPMLDCPARMNTSVGALSAPPRALTATADXXXXXXXXXXXXXSIVPAAGP 51 PP+ P LD + T GA+S PPR T PAA P Sbjct: 499 PPKKPALD--KGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASP 549
>TLE2_HUMAN (Q04725) Transducin-like enhancer protein 2 (ESG2)| Length = 743 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 251 SGGTTPSQRFPDVAPPRPPMLDCPARMNTSVGALSAPPRA 132 S TTP + P P R ++D PA + +S+G S PRA Sbjct: 249 SPATTPCGKVPICIPARRDLVDSPASLASSLG--SPLPRA 286
>POLN_HEVPA (P33424) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -2 Query: 239 TPSQRFPDVAPPRPPMLDCPARMNTSVGALSAPPRALTATA 117 TP+ P AP P L PAR + GA + P TA Sbjct: 735 TPAAPLPPPAPDPSPTLSAPARGEPAPGATARAPAITHQTA 775
>NID2_HUMAN (Q14112) Nidogen-2 precursor (NID-2) (Osteonidogen)| Length = 1375 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 235 GVVPPECAPSPRTLRLSPSL--RWEE 306 G PP C PSP + P++ RW E Sbjct: 999 GSTPPHCGPSPEPTQRPPTICERWRE 1024 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,465,406 Number of Sequences: 219361 Number of extensions: 472015 Number of successful extensions: 2301 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2296 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)