| Clone Name | bast58h11 |
|---|---|
| Clone Library Name | barley_pub |
>GH38_ORYSA (Q7XIN9) Probable indole-3-acetic acid-amido synthetase GH3.8 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 8) (OsGH3-8) Length = 605 Score = 65.1 bits (157), Expect = 4e-11 Identities = 40/69 (57%), Positives = 43/69 (62%) Frame = +1 Query: 154 MAAMTDVSRAIGAALRSPASSPVXXXXXXXXXXXXXXLRFIDEMTCNVDSVQERVLAEIL 333 MA MTDVS G ALR+PA+ V LRFIDEMT NVD+VQERVL EIL Sbjct: 1 MAVMTDVSTT-GTALRTPAAGAVKEGDVEK-------LRFIDEMTTNVDAVQERVLGEIL 52 Query: 334 ARNVDTEYL 360 RN TEYL Sbjct: 53 GRNAGTEYL 61
>GH31_ARATH (O82333) Probable indole-3-acetic acid-amido synthetase GH3.1 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 1) (AtGH3-1) Length = 590 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 265 LRFIDEMTCNVDSVQERVLAEILARNVDTEYLK 363 LRFI+EMT N D+VQE +LAEILARN DTEYL+ Sbjct: 23 LRFIEEMTRNADTVQENLLAEILARNADTEYLR 55
>GH310_ORYSA (Q6ZLA7) Putative indole-3-acetic acid-amido synthetase GH3.10 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 10) (OsGH3-10) Length = 478 Score = 53.1 bits (126), Expect = 2e-07 Identities = 32/59 (54%), Positives = 37/59 (62%) Frame = +1 Query: 184 IGAALRSPASSPVXXXXXXXXXXXXXXLRFIDEMTCNVDSVQERVLAEILARNVDTEYL 360 IGAA RS +SS + LR I+E+T NVD+VQERVLAEIL RN D EYL Sbjct: 9 IGAASRSLSSSLMAAAKEPDVEN----LRLIEELTSNVDAVQERVLAEILGRNADAEYL 63
>GH33_ARATH (O22190) Indole-3-acetic acid-amido synthetase GH3.3 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 3) (AtGH3-3) Length = 595 Score = 50.8 bits (120), Expect = 8e-07 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +1 Query: 184 IGAALRSPAS-SPVXXXXXXXXXXXXXXLRFIDEMTCNVDSVQERVLAEILARNVDTEYL 360 + +ALRSP SP LRFI+EMT NVD VQ++V+ EIL+RN DTEYL Sbjct: 3 VDSALRSPMMHSP--------STKDVKALRFIEEMTRNVDFVQKKVIREILSRNSDTEYL 54 Query: 361 K 363 K Sbjct: 55 K 55
>GH32_ARATH (Q9SZT9) Indole-3-acetic acid-amido synthetase GH3.2 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 2) (AtGH3-2) (YADOKARI 1 protein) Length = 549 Score = 49.7 bits (117), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 265 LRFIDEMTCNVDSVQERVLAEILARNVDTEYLK 363 L+FI+EMT N DSVQE+VL EIL RN +TEYLK Sbjct: 24 LKFIEEMTRNPDSVQEKVLGEILTRNSNTEYLK 56
>GH34_ARATH (Q9LQ68) Indole-3-acetic acid-amido synthetase GH3.4 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 4) (AtGH3-4) (CF4-like protein) Length = 597 Score = 49.7 bits (117), Expect = 2e-06 Identities = 28/61 (45%), Positives = 38/61 (62%) Frame = +1 Query: 181 AIGAALRSPASSPVXXXXXXXXXXXXXXLRFIDEMTCNVDSVQERVLAEILARNVDTEYL 360 A+ + L+S +SP L+FI+E+T N DSVQE+VL EIL+RN +TEYL Sbjct: 2 AVDSLLQSGMASPTTSETEVKA------LKFIEEITRNPDSVQEKVLGEILSRNSNTEYL 55 Query: 361 K 363 K Sbjct: 56 K 56
>GH36_ARATH (Q9LSQ4) Indole-3-acetic acid-amido synthetase GH3.6 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 6) (AtGH3-6) (DWARF IN LIGHT 1 protein) (DFL-1) Length = 612 Score = 46.6 bits (109), Expect = 1e-05 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +1 Query: 265 LRFIDEMTCNVDSVQERVLAEILARNVDTEYLK 363 L+FI+++T N D VQ RVL EIL+RN D EYLK Sbjct: 25 LQFIEDVTTNADDVQRRVLEEILSRNADVEYLK 57
>GH32_ORYSA (P0C0M2) Probable indole-3-acetic acid-amido synthetase GH3.2 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 2) (OsGH3-2) Length = 614 Score = 45.1 bits (105), Expect = 4e-05 Identities = 26/61 (42%), Positives = 32/61 (52%) Frame = +1 Query: 181 AIGAALRSPASSPVXXXXXXXXXXXXXXLRFIDEMTCNVDSVQERVLAEILARNVDTEYL 360 A+ AA ++ V L FI+EMT D+VQERVLA ILARN EYL Sbjct: 5 AVAAAEAGSKAAAVAGKAVAACERDAEKLEFIEEMTRGFDAVQERVLAAILARNNGAEYL 64 Query: 361 K 363 + Sbjct: 65 R 65
>GH35_ARATH (O81829) Indole-3-acetic acid-amido synthetase GH3.5 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 5) (AtGH3-5) Length = 612 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = +1 Query: 265 LRFIDEMTCNVDSVQERVLAEILARNVDTEYLK 363 L+ I+E+T N D VQ +VL EIL RN D EYL+ Sbjct: 25 LQLIEELTSNADQVQRQVLEEILTRNADVEYLR 57
>GH31_ORYSA (Q8LQM5) Probable indole-3-acetic acid-amido synthetase GH3.1 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 1) (OsGH3-1) Length = 610 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 265 LRFIDEMTCNVDSVQERVLAEILARNVDTEYLK 363 L FI+ +T N VQ RVL EILA+N EYL+ Sbjct: 24 LEFIEHVTANAGQVQRRVLGEILAQNAPAEYLR 56
>GH34_ORYSA (Q60EJ6) Probable indole-3-acetic acid-amido synthetase GH3.4 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 4) (OsGH3-4) Length = 629 Score = 35.0 bits (79), Expect = 0.045 Identities = 19/52 (36%), Positives = 23/52 (44%) Frame = +1 Query: 208 ASSPVXXXXXXXXXXXXXXLRFIDEMTCNVDSVQERVLAEILARNVDTEYLK 363 A SP L I+ +T N Q RVL EILA+N EYL+ Sbjct: 8 AVSPAAAAATAMCAEHREKLEHIERVTRNAGQEQRRVLEEILAQNAQAEYLR 59
>GH37_ORYSA (Q654M1) Probable indole-3-acetic acid-amido synthetase GH3.7 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 7) (OsGH3-7) Length = 620 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 274 IDEMTCNVDSVQERVLAEILARNVDTEYLK 363 I +T + +Q VL EIL+RN TEYL+ Sbjct: 20 IHRLTADAAGIQRGVLREILSRNSGTEYLR 49
>CLCD_RHOOP (O67988) Carboxymethylenebutenolidase (EC 3.1.1.45) (Dienelactone| hydrolase) (DLH) Length = 252 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 285 HLVDEAQLLGVLGFCCGRS 229 H VD+ Q GVLGFC G S Sbjct: 112 HTVDDQQTFGVLGFCLGGS 130
>R1_ARATH (Q9SAC6) Alpha-glucan water dikinase, chloroplast precursor (EC| 2.7.9.4) (Starch-related R1 protein) (Starch excess protein 1) Length = 1399 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 333 EDLGQDALLHGVDVAGHLVDEAQLLGVLGF 244 E Q + +H ++A LVDEA+ G LGF Sbjct: 505 ESEAQKSFMHRFNIAADLVDEAKSAGQLGF 534
>SUBS_BACLE (P29600) Subtilisin Savinase (EC 3.4.21.62) (Alkaline protease)| Length = 269 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 342 VPGEDLGQDALLHGVDVAGHLVDEAQLLGVLG 247 VPGE QD HG VAG + +GVLG Sbjct: 50 VPGEPSTQDGNGHGTHVAGTIAALNNSIGVLG 81
>SUBB_BACLE (P29599) Subtilisin BL (EC 3.4.21.62) (Alkaline protease)| Length = 269 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 342 VPGEDLGQDALLHGVDVAGHLVDEAQLLGVLG 247 VPGE QD HG VAG + +GVLG Sbjct: 50 VPGEPSTQDGNGHGTHVAGTIAALNNSIGVLG 81
>PRTM_BACSK (Q99405) M-protease precursor (EC 3.4.21.-)| Length = 380 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 342 VPGEDLGQDALLHGVDVAGHLVDEAQLLGVLG 247 VPGE QD HG VAG + +GVLG Sbjct: 161 VPGEPSTQDGNGHGTHVAGTIAALNNSIGVLG 192
>ELYA_BACCS (P41362) Alkaline protease precursor (EC 3.4.21.-)| Length = 380 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 342 VPGEDLGQDALLHGVDVAGHLVDEAQLLGVLG 247 VPGE QD HG VAG + +GVLG Sbjct: 161 VPGEPSTQDGNGHGTHVAGTIAALNNSIGVLG 192
>ELYA_BACAO (P27693) Alkaline protease precursor (EC 3.4.21.-)| Length = 380 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 342 VPGEDLGQDALLHGVDVAGHLVDEAQLLGVLG 247 VPGE QD HG VAG + +GVLG Sbjct: 161 VPGEPSTQDGNGHGTHVAGTIAALNNSIGVLG 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,223,673 Number of Sequences: 219361 Number of extensions: 446465 Number of successful extensions: 1178 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1178 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)