| Clone Name | bast58h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MA2B1_HUMAN (O00754) Lysosomal alpha-mannosidase precursor (EC 3... | 28 | 6.6 | 2 | MA2B1_MACFA (Q60HE9) Lysosomal alpha-mannosidase precursor (EC 3... | 28 | 6.6 |
|---|
>MA2B1_HUMAN (O00754) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24)| (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1) [Contains: Lysosomal alpha-mannosidase A peptide; Lysosomal alpha-mannosidase Length = 1010 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +3 Query: 15 AASSQYHPPQLRYSVQLPPVG---WCAAVS*SWRP 110 ++ SQ HPP+L +S LP +G + A W+P Sbjct: 553 SSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKP 587
>MA2B1_MACFA (Q60HE9) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24)| (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1) Length = 1012 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +3 Query: 15 AASSQYHPPQLRYSVQLPPVG---WCAAVS*SWRP 110 ++ SQ HPP+L +S LP +G + A W+P Sbjct: 555 SSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKP 589 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,964,198 Number of Sequences: 219361 Number of extensions: 253591 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)