| Clone Name | bast58h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | C79A1_SORBI (Q43135) Cytochrome P450 79A1 (EC 1.14.13.41) (Tyros... | 75 | 3e-14 | 2 | C79A2_ARATH (Q9FLC8) Cytochrome P450 79A2 (EC 1.-.-.-) | 70 | 2e-12 | 3 | C79B1_SINAL (O81345) Cytochrome P450 79B1 (EC 1.14.-.-) | 64 | 9e-11 | 4 | C79B2_ARATH (O81346) Cytochrome P450 79B2 (EC 1.14.-.-) | 63 | 2e-10 |
|---|
>C79A1_SORBI (Q43135) Cytochrome P450 79A1 (EC 1.14.13.41) (Tyrosine| N-monooxygenase) (Cytochrome P450Tyr) Length = 557 Score = 75.5 bits (184), Expect = 3e-14 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +3 Query: 192 GSLPELKLFNKLPAFRWIHQVMEKMNTDIACFRLGGVHVIPITCPRIARE 341 G+LPE+ L NK PAFRWIHQ+M +M TDIAC +LGGVHV+ ITCP IARE Sbjct: 78 GNLPEM-LLNK-PAFRWIHQMMREMGTDIACVKLGGVHVVSITCPEIARE 125
>C79A2_ARATH (Q9FLC8) Cytochrome P450 79A2 (EC 1.-.-.-)| Length = 529 Score = 69.7 bits (169), Expect = 2e-12 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 192 GSLPELKLFNKLPAFRWIHQVMEKMNTDIACFRLGGVHVIPITCPRIARE 341 G+LPE+ NK P FRWIH +M+++NTDIAC RL HVIP+T PRIARE Sbjct: 51 GNLPEILGRNK-PVFRWIHSLMKELNTDIACIRLANTHVIPVTSPRIARE 99
>C79B1_SINAL (O81345) Cytochrome P450 79B1 (EC 1.14.-.-)| Length = 542 Score = 63.9 bits (154), Expect = 9e-11 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +3 Query: 228 PAFRWIHQVMEKMNTDIACFRLGGVHVIPITCPRIARE 341 P FRW+H +M+++NT+IAC RLG HVI +TCP+IARE Sbjct: 78 PVFRWLHSIMKQLNTEIACVRLGSTHVITVTCPKIARE 115
>C79B2_ARATH (O81346) Cytochrome P450 79B2 (EC 1.14.-.-)| Length = 541 Score = 62.8 bits (151), Expect = 2e-10 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = +3 Query: 228 PAFRWIHQVMEKMNTDIACFRLGGVHVIPITCPRIARE 341 P FRW+H +M+++NT+IAC +LG HVI +TCP+IARE Sbjct: 77 PVFRWLHSIMKQLNTEIACVKLGNTHVITVTCPKIARE 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,038,657 Number of Sequences: 219361 Number of extensions: 415457 Number of successful extensions: 968 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)