| Clone Name | bast58e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLYG1_SOYBN (P04776) Glycinin G1 precursor [Contains: Glycinin A... | 31 | 1.8 | 2 | SYE_MYCMO (Q6KIT3) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Gluta... | 29 | 5.2 | 3 | RPTOR_MOUSE (Q8K4Q0) Regulatory associated protein of mTOR (Rapt... | 28 | 8.9 |
|---|
>GLYG1_SOYBN (P04776) Glycinin G1 precursor [Contains: Glycinin A1a subunit;| Glycinin Bx subunit] Length = 495 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 14 CRSSPQTCQRRRGTQQKNMGNGDDEKV 94 C+ + CQR RG+Q K+ NG DE + Sbjct: 290 CKGKDKHCQRPRGSQSKSRRNGIDETI 316
>SYE_MYCMO (Q6KIT3) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 464 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 43 SPRNPAEKYGKWRRRE 90 SP+NP EKYGK+R+ E Sbjct: 74 SPKNPNEKYGKYRQSE 89
>RPTOR_MOUSE (Q8K4Q0) Regulatory associated protein of mTOR (Raptor) (P150| target of rapamycin (TOR)-scaffold protein) Length = 1335 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 4 VLHVSKLTTDVPASPRNPAEKYGKWRRREGGRPPPLSTA 120 +L S LT PASP N G + GG PP ST+ Sbjct: 850 ILDTSSLTQSAPASPTNK----GMHMHQVGGSPPASSTS 884 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.130 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,290,276 Number of Sequences: 219361 Number of extensions: 468057 Number of successful extensions: 1438 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1438 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)