| Clone Name | bast58e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RISB_BACTN (Q89ZW8) 6,7-dimethyl-8-ribityllumazine synthase (EC ... | 29 | 4.7 | 2 | TERT_HUMAN (O14746) Telomerase reverse transcriptase (EC 2.7.7.4... | 29 | 6.2 | 3 | MDTC_ERWCT (Q6D2B0) Multidrug resistance protein mdtC (Multidrug... | 29 | 6.2 | 4 | PARD3_HUMAN (Q8TEW0) Partitioning-defective 3 homolog (PARD-3) (... | 28 | 8.1 |
|---|
>RISB_BACTN (Q89ZW8) 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.9) (DMRL| synthase) (Lumazine synthase) (Riboflavin synthase beta chain) Length = 143 Score = 29.3 bits (64), Expect = 4.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 444 CIDSGDTPKTLALALGAGQGIWSSNSTG 361 C+ GDTP + +GA QGI N+TG Sbjct: 68 CVIKGDTPHFDYVCMGATQGITELNATG 95
>TERT_HUMAN (O14746) Telomerase reverse transcriptase (EC 2.7.7.49) (Telomerase| catalytic subunit) (HEST2) (Telomerase-associated protein 2) (TP2) Length = 1132 Score = 28.9 bits (63), Expect = 6.2 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 298 PADVHPPPAAPRGGRVVGVRHL-ARQRHRLAQRGEQQL 188 P D PPPAAP +V ++ L AR RL +RG + + Sbjct: 59 PWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNV 96
>MDTC_ERWCT (Q6D2B0) Multidrug resistance protein mdtC (Multidrug transporter| mdtC) Length = 1026 Score = 28.9 bits (63), Expect = 6.2 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 347 GFLGLPVEFELQIPCPAPSASASVFGVSPESM 442 GF LPV Q+ P S SAS+ G SPE+M Sbjct: 28 GFRLLPVSPLPQVDFPVISVSASLAGASPETM 59
>PARD3_HUMAN (Q8TEW0) Partitioning-defective 3 homolog (PARD-3) (PAR-3)| (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha) Length = 1356 Score = 28.5 bits (62), Expect = 8.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 319 DVADVGGPADVHPPPAAPRGGRVVGV 242 +V + GGP +H P + RGGR +G+ Sbjct: 276 EVPNDGGPLGIHVVPFSARGGRTLGL 301 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,420,151 Number of Sequences: 219361 Number of extensions: 398434 Number of successful extensions: 2181 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2180 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)