| Clone Name | bast58b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZC3H6_MOUSE (Q8BYK8) Zinc finger CCCH-type domain-containing pro... | 28 | 8.2 | 2 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 28 | 8.2 |
|---|
>ZC3H6_MOUSE (Q8BYK8) Zinc finger CCCH-type domain-containing protein 6| Length = 1177 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 193 SHCPCLLFSETTTKGTGLAESAGKEDPVELDSSP 294 SHCP ++S ++ G G G E PV SP Sbjct: 464 SHCPQRMYSSESSPGPGSKVPQGCESPVRHPGSP 497
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.5 bits (62), Expect = 8.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 201 SLSTIQRNHNQGNGLGGISGERRPC 275 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,999,691 Number of Sequences: 219361 Number of extensions: 1259687 Number of successful extensions: 2926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2925 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)