| Clone Name | bast58b09 |
|---|---|
| Clone Library Name | barley_pub |
>SMN_RAT (O35876) Survival motor neuron protein| Length = 289 Score = 32.7 bits (73), Expect = 0.45 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -1 Query: 207 RGTGRSRPGKERSSPRRRVNGELKEWSGAEGAAVVW 100 +GT R +P K+ + ++ LK+W + + VW Sbjct: 65 KGTARRKPAKKNKNQKKNATAPLKQWKAGDKCSAVW 100
>SMN_MOUSE (P97801) Survival motor neuron protein| Length = 288 Score = 32.0 bits (71), Expect = 0.76 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 207 RGTGRSRPGKERSSPRRRVNGELKEWSGAEGAAVVW 100 +GT R +P K+ S ++ LK+W + + VW Sbjct: 64 KGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVW 99
>MILK2_HUMAN (Q8IY33) MICAL-like protein 2| Length = 904 Score = 30.8 bits (68), Expect = 1.7 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = -3 Query: 361 ECRCPWVGAA--AASEREVEI*TGELPPAPASVPR*WLLTSLLPERSRKLRVDSGDGEEP 188 +C C A A E + T LP A ++ P+ LT L+P + + VDS P Sbjct: 217 QCSCTLHSGAYKATGEPGTFVCTSHLPAAASASPK---LTGLVPRQPGAMGVDSRTSCSP 273 Query: 187 SGEREEQSSPPGQW 146 +E + P W Sbjct: 274 QKAQEANKARPSAW 287
>HA1B_BOVIN (P13753) BOLA class I histocompatibility antigen, alpha chain BL3-7| precursor Length = 364 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -1 Query: 153 VNGELKEWSGAEGAAVVWWRPWE--GAARRW 67 +N EL+ W+ A+ AA + R WE GAA W Sbjct: 153 LNEELRSWTAADTAAQITKRKWEAAGAAETW 183
>GON1_MORSA (O73812) Progonadoliberin-1 precursor (Progonadoliberin I)| [Contains: Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasing hormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I) (Luliberin I); GnRH-associated peptide 1 (G Length = 95 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 372 WAHGLDPGAPDRRDGRKEPLGSSI--GFP 452 W++GL PG DG E LG+ I GFP Sbjct: 25 WSYGLSPGGKRELDGLSETLGNQIVGGFP 53
>CO9A1_HUMAN (P20849) Collagen alpha-1(IX) chain precursor| Length = 921 Score = 30.4 bits (67), Expect = 2.2 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 432 PEAPSGHPGGRERLGPVREPKITENADALGWVLLP 328 P P G PG R LGPV P + +LG LP Sbjct: 617 PRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLP 651
>CAC1A_RABIT (P27884) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2424 Score = 29.6 bits (65), Expect = 3.8 Identities = 28/71 (39%), Positives = 32/71 (45%), Gaps = 4/71 (5%) Frame = +2 Query: 158 RRGLLLSFP----GRLLPVPRIHPQLSGPLRQQASQQPLARHGGRRWWQLAGSDLHLALA 325 RRGL+LS P G L PR HP + + +R GGRRW AG Sbjct: 2365 RRGLVLSPPPPPPGEL--APRAHPARTP---RPGPGDSRSRRGGRRWTASAGK------G 2413 Query: 326 GGSSTHPRASA 358 GG PRASA Sbjct: 2414 GGG---PRASA 2421
>RRMJ3_CHICK (Q5ZKM1) Putative rRNA methyltransferase 3 (EC 2.1.1.-) (rRNA| (uridine-2'-O-)-methyltransferase 3) Length = 832 Score = 29.3 bits (64), Expect = 4.9 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 253 LTSLLPERSRKLRVDSGDGEEPSGEREEQSSPP 155 LT L E++++L ++ GEE G EE+ + P Sbjct: 319 LTKKLKEQAKELDINLSSGEEEEGREEEEKTSP 351
>MARCS_HUMAN (P29966) Myristoylated alanine-rich C-kinase substrate (MARCKS)| (Protein kinase C substrate, 80 kDa protein, light chain) (PKCSL) (80K-L protein) Length = 331 Score = 29.3 bits (64), Expect = 4.9 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 4/80 (5%) Frame = +3 Query: 225 LDLSGSRLVSSH*RGTEAGAGGSSPVQISTSRSLAAAAPTQG----HLHSP*SWAHGLDP 392 L +GS + AG+G +SP AAAAP G +P + +P Sbjct: 57 LQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAP-AEGEAAEP 115 Query: 393 GAPDRRDGRKEPLGSSIGFP 452 G+P +G SS P Sbjct: 116 GSPTAAEGEAASAASSTSSP 135
>CEND3_HUMAN (Q8WWN8) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 3) Length = 1544 Score = 29.3 bits (64), Expect = 4.9 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 6/58 (10%) Frame = +3 Query: 264 RGTEAGAGGSSPVQISTSRSLAAAAPTQG--HLHSP*SWAHGLDP----GAPDRRDGR 419 RG A +P S A PT G H+ P +G+ P GAPDRR+ R Sbjct: 166 RGRAQAAQDKAPDSSQISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESR 223
>IP5PC_ARATH (Q84W55) Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC| 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein) Length = 1101 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 132 WSGAEGAAVVWWRPWEGA 79 WSG+EG A+ W PW+GA Sbjct: 242 WSGSEGGALKVW-PWDGA 258
>ANK2_HUMAN (Q01484) Ankyrin-2 (Brain ankyrin) (Ankyrin-B) (Ankyrin,| nonerythroid) Length = 3924 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 286 PAPASVPR*WLLTSLLPERSRKLRVDSGDGEEPSGEREEQSSPPGQ 149 P PA+V + LLT + RSR LR G E+ S E+ G+ Sbjct: 2455 PLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGK 2500
>KCNN3_HUMAN (Q9UGI6) Small conductance calcium-activated potassium channel| protein 3 (SK3) (SKCa3) Length = 736 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/69 (24%), Positives = 33/69 (47%) Frame = -3 Query: 361 ECRCPWVGAAAASEREVEI*TGELPPAPASVPR*WLLTSLLPERSRKLRVDSGDGEEPSG 182 +C CP G +++ + PPAP + P+ L SL P+ +L+ ++ Sbjct: 20 KCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQ-PPQLQQQQQQQQQQQQ 78 Query: 181 EREEQSSPP 155 ++++Q PP Sbjct: 79 QQQQQQQPP 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,670,412 Number of Sequences: 219361 Number of extensions: 902470 Number of successful extensions: 3899 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3897 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)