| Clone Name | bast58a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ELK4_HUMAN (P28324) ETS domain-containing protein Elk-4 (Serum r... | 30 | 2.0 | 2 | MALE_PYRAB (Q9V297) Maltotriose-binding protein precursor (Malto... | 30 | 2.7 | 3 | TAF9B_HUMAN (Q9HBM6) Transcription initiation factor TFIID subun... | 29 | 5.9 | 4 | PODXL_MOUSE (Q9R0M4) Podocalyxin-like protein 1 precursor | 28 | 7.7 |
|---|
>ELK4_HUMAN (P28324) ETS domain-containing protein Elk-4 (Serum response factor| accessory protein 1) (SAP-1) Length = 431 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 166 SVMKPSYPTITTPTSASYAMPAYTPMTPSSRFPSLAD 276 +++ P P++ PTSAS M A+ P S P L + Sbjct: 227 TLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQE 263
>MALE_PYRAB (Q9V297) Maltotriose-binding protein precursor| (Maltodextrin-binding protein) (MMBP) Length = 453 Score = 30.0 bits (66), Expect = 2.7 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +1 Query: 55 IGAYLLVLLAFCCCGAEQRRVEASNRLTQHPRILTTVSVMKPSYPTITTPTSASYAMPAY 234 +G + ++A C G Q + E TQ P T + +PS T T+PT + P Sbjct: 11 VGVLIFSVVASGCIGGTQTQTE-----TQTPEKTQTPTTTQPSPTTTTSPTQTTSQTPTE 65 Query: 235 T 237 T Sbjct: 66 T 66
>TAF9B_HUMAN (Q9HBM6) Transcription initiation factor TFIID subunit 9B| (Transcription initiation factor TFIID subunit 9-like protein) (Transcription-associated factor TAFII31L) (Neuronal cell death-related protein 7) (DN-7) Length = 251 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 145 PRILTTVSVMKPSYPTITTPTSASYAMPAYTPMTPSSR 258 PR+ KP+ PTI TP + S TPM+ +S+ Sbjct: 144 PRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQ 181
>PODXL_MOUSE (Q9R0M4) Podocalyxin-like protein 1 precursor| Length = 503 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 100 AEQRRVEASNRLTQHPRILTTVSVMKPSYPTITTPTSASYAMPAYTPMTPSSR 258 + Q ++ T HP + +T++ +PS PT T ++ S +MP TP S++ Sbjct: 39 SHQSATTSTEVTTGHP-VASTLASTQPSNPTPFTTSTQSPSMPTSTPNPTSNQ 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,817,900 Number of Sequences: 219361 Number of extensions: 479395 Number of successful extensions: 1912 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1906 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)