| Clone Name | bast57h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GRIP2_RAT (Q9WTW1) Glutamate receptor-interacting protein 2 (GRI... | 27 | 8.8 |
|---|
>GRIP2_RAT (Q9WTW1) Glutamate receptor-interacting protein 2 (GRIP2 protein)| (AMPA receptor-interacting protein GRIP2) Length = 1043 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = -1 Query: 362 WRRGVGHRRPDDDG----RAVDRRACDGAL 285 WR GV RRP DDG D DGAL Sbjct: 8 WRLGVVRRRPKDDGPYSKGGKDTAGTDGAL 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,117,537 Number of Sequences: 219361 Number of extensions: 142835 Number of successful extensions: 520 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)