| Clone Name | bast57e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HRX_MOUSE (P55200) Zinc finger protein HRX (ALL-1) (Fragment) | 29 | 3.1 | 2 | HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-li... | 29 | 3.1 | 3 | RL4_MYCPN (P75579) 50S ribosomal protein L4 | 28 | 5.2 | 4 | ATG2_MAGGR (Q51ZN8) Autophagy-related protein 2 | 28 | 6.8 |
|---|
>HRX_MOUSE (P55200) Zinc finger protein HRX (ALL-1) (Fragment)| Length = 3866 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 112 SGGPHPISHSAVSTTPPH 165 S GP IS++AV TTPPH Sbjct: 2949 SPGPSQISNAAVQTTPPH 2966
>HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)| Length = 3969 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 112 SGGPHPISHSAVSTTPPH 165 S GP IS++AV TTPPH Sbjct: 3053 SPGPSQISNAAVQTTPPH 3070
>RL4_MYCPN (P75579) 50S ribosomal protein L4| Length = 212 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +1 Query: 82 HTLIFEGVSLSGGPHPISHSAV------STTPPHFAGGGRSFG 192 H+++ +G GG P ST PHF GGG FG Sbjct: 50 HSILTKGEVRGGGKKPYKQKHTGKARQGSTRNPHFVGGGIVFG 92
>ATG2_MAGGR (Q51ZN8) Autophagy-related protein 2| Length = 2077 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 82 HTLIFEGVSLSGGPHPISHSAVSTTPPHFAGGGRSFGRS 198 H + +G S G P P+S S S+ PH G +FG S Sbjct: 612 HVVPLDGQSSPGEPQPLSPSLASSVFPHVPG---AFGAS 647 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,305,237 Number of Sequences: 219361 Number of extensions: 490517 Number of successful extensions: 1572 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1571 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)