| Clone Name | bast57a12 |
|---|---|
| Clone Library Name | barley_pub |
>TNR1B_MOUSE (P25119) Tumor necrosis factor receptor superfamily member 1B| precursor (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (p75) (p80 TNF-alpha receptor) Length = 474 Score = 33.5 bits (75), Expect = 0.27 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = -2 Query: 240 CRRPRR*ISACTGTRRCRTPCHLCTCRCHCSRLDPC----GTASSAARRNPCLRRASLPA 73 C + + + AC R C H +CR C RL C G ASS A L +A P Sbjct: 111 CTKQQNRVCACEAGRYCALKTHSGSCR-QCMRLSKCGPGFGVASSRAPNGNVLCKACAPG 169 Query: 72 T 70 T Sbjct: 170 T 170
>POLN_SLDV (Q8QL53) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC 3.6.1.1 Length = 2593 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 225 DEDAGSSHCAKGASTAAVRSGRRATGGGVSFAY*YATTNIKQSDAHSTTPSST 383 D+D GS +GA+ R G+R GG F+ T ++ Q H+T ++T Sbjct: 1957 DQDTGSEPSGRGAAVRTRRRGQRDGPGGYIFSSDQGTAHLSQ---HNTQTNNT 2006
>CBF3B_YEAST (P40969) Centromere DNA-binding protein complex CBF3 subunit B| (Centromere protein 3) Length = 608 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 195 RCRTPCHLCTCR-CHCSRLDPCGTASSAARRNPCLRRASL 79 + + PC +CT R C R+ PCG + + C++ L Sbjct: 9 KSKHPCSVCTRRKVKCDRMIPCGNCRKRGQDSECMKSTKL 48
>PRM2_RATFU (Q91VE1) Protamine-2 (Protamine-P2) (Sperm histone P2)| Length = 105 Score = 30.0 bits (66), Expect = 3.0 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -2 Query: 294 HGVLTARPRWRRPWRSGCCRRPRR*ISACTGTRRCRTPCHLCTCRCH 154 H + R RR R CC R R RR R C C CH Sbjct: 59 HRIHKRRRSCRRRRRHSCCHRRRHRRGCRRSRRRRRCKCRKCRRHCH 105
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 30.0 bits (66), Expect = 3.0 Identities = 21/63 (33%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = -2 Query: 249 SGCCRRPRR*ISACTGTRRCRTPCHLCTCRCHCSRLDPCGTA---SSAARRNPCLRRASL 79 S CC+ R AC CRT C TC C CG++ SS+ C R Sbjct: 45 SSCCQPCCR--PACCQNTCCRTTCCQPTCLSSCCGQTSCGSSCGQSSSCAPVYCRRTCYY 102 Query: 78 PAT 70 P T Sbjct: 103 PTT 105
>HEMZ_RHOS4 (P51008) Coproporphyrinogen III oxidase, anaerobic 2 (EC 1.3.99.22)| (Coproporphyrinogenase) (Coprogen oxidase) Length = 450 Score = 29.6 bits (65), Expect = 3.9 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -2 Query: 192 CRTPCHLCTCRCHCSRLD-PCGTASSAARRNPCLRRASLPATKGMRRRSWGYGGWP 28 CR C C CR + D P ++A + L RA L + R WG GG P Sbjct: 60 CRRLCWFCACRTQGTSSDAPVRAYAAALKSELALLRARLAPGVRLARMHWG-GGTP 114
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 29.3 bits (64), Expect = 5.1 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = -2 Query: 252 RSGCCRRPRR*ISACTGTRRCRTPCHLCTCRCHCSRLDPCGTASSAARRNPC 97 R+ CCR P +S+C + C+T C TC CH P SS R C Sbjct: 32 RTTCCR-PSCCVSSCCRPQCCQTTCCRTTC-CH-----PSCCVSSCCRPQCC 76
>ODFP_BOVIN (Q29438) Outer dense fiber protein| Length = 262 Score = 29.3 bits (64), Expect = 5.1 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 Query: 246 GCCRRPRR*ISACTGTRRCRTPCHLCTCRCHCSRLDPCGTASSAARRNPC 97 G C + CT PC+ C+ C+ +PC S + NPC Sbjct: 193 GSCVKIESPCYPCTSPCNPCNPCNPCSPCSPCNPCNPCSPCSPCSPCNPC 242
>MT_ICTPU (O93571) Metallothionein (MT)| Length = 60 Score = 29.3 bits (64), Expect = 5.1 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -2 Query: 207 TGTRRCRTPCHLCTCRCHCSRLDPCGTASSAARR 106 TGT C T C C+C C + C S + Sbjct: 9 TGTCNCGTSCKCSNCQCACCKKSCCSCCPSGCSK 42
>KR410_HUMAN (Q9BYQ7) Keratin-associated protein 4-10 (Keratin-associated| protein 4.10) (Ultrahigh sulfur keratin-associated protein 4.10) Length = 127 Score = 28.9 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = -2 Query: 249 SGCCR--------RPRR*ISACTGTRRCRTPCHLCTCRCHCSRLDPCGTA 124 S CCR RP +S+C C+T C CR C R CG++ Sbjct: 81 SSCCRPLCCQTTCRPSCGVSSCCRPLCCQTTC----CRTTCCRPSCCGSS 126
>POLN_SPDV (Q8JJX1) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC 3.6.1.1 Length = 2601 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 225 DEDAGSSHCAKGASTAAVRSGRRATGGGVSFAY*YATTNIKQSDAHSTTPSST 383 D+D G+ ++GA+ R G+R GG F+ T ++ Q H+T ++T Sbjct: 1965 DQDTGTEPSSRGAAVRTRRRGQRDGLGGYIFSSDQGTAHLSQ---HNTQTNNT 2014
>SPB4_EMENI (Q5B8F4) ATP-dependent rRNA helicase spb4 (EC 3.6.1.-)| Length = 638 Score = 28.9 bits (63), Expect = 6.7 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -1 Query: 304 PPVARRPDRTAAVEAPLAQWLLPASSSMNICLHRHSTLQNALSPLYM 164 PP AV PL++W+L A SSM R + +Q + PL+M Sbjct: 5 PPSGTSSRAWDAVNPPLSEWVLDAVSSMGFT--RMTPVQASAIPLFM 49
>FA12_PIG (O97507) Coagulation factor XII precursor (EC 3.4.21.38) (Hageman| factor) (HAF) [Contains: Coagulation factor XIIa heavy chain; Coagulation factor XIIa light chain] Length = 616 Score = 28.9 bits (63), Expect = 6.7 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -2 Query: 183 PCHLCTCRCHCSRLDPCGTASSAARRNPCLRRASLPATKGMR--RRSWGYGGWPC 25 P + C+C + AS NPCL S T+G R R GY G C Sbjct: 155 PAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLC 209
>ODFP_RAT (P21769) Outer dense fiber protein (Protein RT7) (RTS 5/1)| Length = 245 Score = 28.9 bits (63), Expect = 6.7 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 192 CRTPCHLCTCRCHCSRLDPCGTASSAARRNPC 97 C +PC+ C CS PCG PC Sbjct: 191 CTSPCNPCNPCSPCSPCGPCGPCGPCGPCGPC 222
>TPT2_BRAOB (P52178) Triose phosphate/phosphate translocator, non-green| plastid, chloroplast precursor (CTPT) Length = 402 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 304 PPVARRPDRTAAVEAPLAQWL-LPASSSMNICLHRHSTLQNAL 179 PP+ RR R A+ ++PL W LP+ SS ++ +R T A+ Sbjct: 44 PPLPRRSWRLASSDSPLRAWSGLPSVSSPSLDTNRFKTAATAV 86
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 Query: 162 RCHCSRLDPCGTASSAARRNPCLRRASLPATKGMR 58 R HCSRL G ++AR P R SLP +G R Sbjct: 1416 REHCSRLLGNGGPQASARPVPPRERGSLPVIEGTR 1450
>NOTC3_RAT (Q9R172) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2319 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -2 Query: 195 RCRTPCHLCTCRCHCSRLDPCGTASSAARRNPCLRRAS 82 RC P L C SR P G +++ PCL S Sbjct: 1314 RCACPPGLSGPSCRVSRASPSGATNTSCAATPCLHGGS 1351
>XFIN_XENLA (P08045) Zinc finger protein Xfin| Length = 1350 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = +3 Query: 99 TGSFLQRCLLCHKDLAENNDIY----MYRGDKAFCSVEC 203 TG +CLLC K ++N+D++ ++ G+K F C Sbjct: 554 TGEKPFKCLLCKKSFSQNSDLHKHWRIHTGEKPFPCYTC 592
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -2 Query: 243 CCRRPRR*ISACTGTRRCRTPCHLCTCRCHCSRLDPC 133 CC RP +C T CRT C TC C + C Sbjct: 79 CCCRP-----SCCQTTCCRTTCCRTTCCCPSCCVSSC 110
>RB_RAT (P33568) Retinoblastoma-associated protein (PP105) (RB) (Fragment)| Length = 899 Score = 28.5 bits (62), Expect = 8.7 Identities = 21/63 (33%), Positives = 29/63 (46%) Frame = -1 Query: 457 LMAVLNSIL*TALXSFLVAFAHVSYVLLGVVLCASDCLMLVVAYQYAKLTPPPVARRPDR 278 L +NS+L + A V + L S LML V + KL+PP + R P + Sbjct: 153 LSTEINSMLVLKVSWITFLLAKGEVVQMEDDLVISFQLMLCVLDYFIKLSPPALLREPYK 212 Query: 277 TAA 269 TAA Sbjct: 213 TAA 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,326,092 Number of Sequences: 219361 Number of extensions: 930948 Number of successful extensions: 3509 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 3264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3482 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)