| Clone Name | bast56h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 21KD_DAUCA (P17407) 21 kDa protein precursor (1.2 protein) | 42 | 7e-04 | 2 | PRLR_HUMAN (P16471) Prolactin receptor precursor (PRL-R) | 29 | 6.0 |
|---|
>21KD_DAUCA (P17407) 21 kDa protein precursor (1.2 protein)| Length = 193 Score = 42.0 bits (97), Expect = 7e-04 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 192 FIRKSCRETQYPSVCMQSLSSYGKPPPRSPQEL 290 FI+ SC T YP+VC QSLS+Y K +PQEL Sbjct: 28 FIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQEL 60
>PRLR_HUMAN (P16471) Prolactin receptor precursor (PRL-R)| Length = 622 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 349 PTYADADRARSALTDSAARASSCGLRGGGLPYDDRLC 239 P + ++A AL + A +S C L+ GGL Y D C Sbjct: 580 PPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPAC 616 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,022,890 Number of Sequences: 219361 Number of extensions: 302447 Number of successful extensions: 1185 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1185 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)