| Clone Name | bast56h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MFS18_MAIZE (P32439) MFS18 protein precursor | 42 | 6e-04 | 2 | NOS3_PIG (Q28969) Nitric-oxide synthase, endothelial (EC 1.14.13... | 29 | 5.2 |
|---|
>MFS18_MAIZE (P32439) MFS18 protein precursor| Length = 128 Score = 42.4 bits (98), Expect = 6e-04 Identities = 25/52 (48%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 96 MEKSTKMXXXXXXXXXXXXTG-AEARNIKTTEAAAASKDAVLQPTTFPPFDR 248 M +S+KM AEARNIKTT DAV+QP TFPPFDR Sbjct: 1 MARSSKMMVAARLLALALAVSTAEARNIKTT-TTEKKDDAVVQPQTFPPFDR 51
>NOS3_PIG (Q28969) Nitric-oxide synthase, endothelial (EC 1.14.13.39)| (EC-NOS) (NOS type III) (NOSIII) (Endothelial NOS) (eNOS) (Constitutive NOS) (cNOS) Length = 1204 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 273 PTPPTRRLSGRTAERSLAGGPRPCW 199 PTPPT + E+ GGP P W Sbjct: 821 PTPPTESVGVEQLEKGSPGGPPPSW 845 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.121 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,182,446 Number of Sequences: 219361 Number of extensions: 281527 Number of successful extensions: 836 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 835 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)