| Clone Name | bast56h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAF1_DROME (P51123) Transcription initiation factor TFIID subuni... | 29 | 2.4 | 2 | Y397_MYCGE (P47637) Hypothetical protein MG397 | 28 | 5.3 |
|---|
>TAF1_DROME (P51123) Transcription initiation factor TFIID subunit 1 (EC| 2.7.11.1) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) (TAFII250) (TBP-associated factor 230 kDa) (p230) Length = 2129 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +1 Query: 259 RNDNPRTTAAGFDPDA----LERAVELLRQFELRPDTDVKK 369 + P+ + G D D L+RA ELLRQF++ P+ ++KK Sbjct: 1024 QESQPKRSVTGTDADLRRLPLQRAKELLRQFKV-PEEEIKK 1063
>Y397_MYCGE (P47637) Hypothetical protein MG397| Length = 566 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/27 (33%), Positives = 21/27 (77%) Frame = +1 Query: 295 DPDALERAVELLRQFELRPDTDVKKAF 375 + ALE+++++L+QF+++ D ++ AF Sbjct: 61 EKQALEQSIKVLKQFQIKFDNEINSAF 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,298,229 Number of Sequences: 219361 Number of extensions: 199947 Number of successful extensions: 404 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)