| Clone Name | bast56g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRAF1_CANFA (Q8HY39) Prenylated Rab acceptor protein 1 (PRA1 fam... | 43 | 4e-04 | 2 | PRAF1_HUMAN (Q9UI14) Prenylated Rab acceptor protein 1 (PRA1 fam... | 42 | 7e-04 | 3 | PRAF1_RAT (O35394) Prenylated Rab acceptor protein 1 (PRA1 famil... | 40 | 0.002 | 4 | PRAF1_MOUSE (Q9Z0S9) Prenylated Rab acceptor protein 1 (PRA1 fam... | 40 | 0.002 | 5 | PRA1_SCHPO (Q9UUN5) PRA1-like protein | 30 | 2.0 | 6 | BRO1_CRYNE (Q5KE13) Vacuolar protein-sorting protein BRO1 (BRO d... | 29 | 4.5 |
|---|
>PRAF1_CANFA (Q8HY39) Prenylated Rab acceptor protein 1 (PRA1 family protein 1)| Length = 185 Score = 42.7 bits (99), Expect = 4e-04 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 215 ESARRSLSDRRPWAEMVDRSAFSRPDSLSDATSRLRRNLTYFRVNY 352 E R + RPW+ VD+ FSRP +L + RL RN+ Y++ NY Sbjct: 33 ERLERRRATIRPWSSFVDQRRFSRPRNLGELCQRLVRNVEYYQSNY 78
>PRAF1_HUMAN (Q9UI14) Prenylated Rab acceptor protein 1 (PRA1 family protein 1)| Length = 185 Score = 42.0 bits (97), Expect = 7e-04 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +2 Query: 245 RPWAEMVDRSAFSRPDSLSDATSRLRRNLTYFRVNY 352 RPW+ VD+ FSRP +L + RL RN+ Y++ NY Sbjct: 43 RPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSNY 78
>PRAF1_RAT (O35394) Prenylated Rab acceptor protein 1 (PRA1 family protein 1)| Length = 185 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 245 RPWAEMVDRSAFSRPDSLSDATSRLRRNLTYFRVNY 352 RPW VD+ FSRP ++ + RL RN+ Y++ NY Sbjct: 43 RPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNY 78
>PRAF1_MOUSE (Q9Z0S9) Prenylated Rab acceptor protein 1 (PRA1 family protein 1)| (Prenylin) Length = 185 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 245 RPWAEMVDRSAFSRPDSLSDATSRLRRNLTYFRVNY 352 RPW VD+ FSRP ++ + RL RN+ Y++ NY Sbjct: 43 RPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNY 78
>PRA1_SCHPO (Q9UUN5) PRA1-like protein| Length = 171 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +2 Query: 203 SRISESARRSLSDRRPWAEMVDRSAFSRPDSLSDATSRLRRNLTYFRVNY 352 S I S + LS + E +D SRP + S+A SR+ N + F NY Sbjct: 16 SEIYASRAQYLSGFKSVGEFLDVRRISRPRNFSEAQSRISFNFSRFSSNY 65
>BRO1_CRYNE (Q5KE13) Vacuolar protein-sorting protein BRO1 (BRO| domain-containing protein 1) Length = 957 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 13 PSRLLESTPRSAPDSAPHGFRADTAAPPPGHQP 111 PSR ++P AP P APPPGH P Sbjct: 888 PSRPTYASPPFAPQQPPMQSGHSPYAPPPGHAP 920 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.133 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,043,449 Number of Sequences: 219361 Number of extensions: 381774 Number of successful extensions: 1245 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1245 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)