| Clone Name | bast56d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNC_RALSO (Q8Y0I1) Ribonuclease III (EC 3.1.26.3) (RNase III) | 30 | 2.9 | 2 | C4BP_MOUSE (P08607) C4b-binding protein precursor (C4bp) | 30 | 3.8 |
|---|
>RNC_RALSO (Q8Y0I1) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 256 Score = 30.0 bits (66), Expect = 2.9 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = -3 Query: 361 IRERGQGERPDLAVLEELVGGDHVLARAAEFELRVT*PTVPAAISGTSSSRRGREQ 194 ++E QG + +A+ + V H A +FE+ T P + +SG+ +SRR EQ Sbjct: 157 LQEYLQGHK--IALPQYAVVATHGAAHNQQFEVECTIPKLEIRVSGSGASRRAAEQ 210
>C4BP_MOUSE (P08607) C4b-binding protein precursor (C4bp)| Length = 469 Score = 29.6 bits (65), Expect = 3.8 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 40 TRASHGRRHRQHLLYPFRQRALQPRAFPCHLQXXXXXXLFFQCTGQPHPPPAV 198 TRA+HGR HR + + L + P Q L+ G+ PPPA+ Sbjct: 12 TRAAHGRLHRNRDVVAWPFSTLCRVSGPTLFQMTFTAALWVAVFGKCGPPPAI 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,306,588 Number of Sequences: 219361 Number of extensions: 511381 Number of successful extensions: 1191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)