| Clone Name | bast56d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMS4_MAIZE (P10580) Hypothetical 29 kDa protein in mitochondrial... | 29 | 4.3 | 2 | ZN297_CANFA (Q5TJE2) Zinc finger protein 297 | 28 | 7.4 | 3 | MPP10_SCHPO (O13910) U3 small nucleolar ribonucleoprotein protei... | 28 | 9.7 |
|---|
>YMS4_MAIZE (P10580) Hypothetical 29 kDa protein in mitochondrial S-1 DNA (URF| 4) Length = 256 Score = 29.3 bits (64), Expect = 4.3 Identities = 21/57 (36%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = +1 Query: 277 WDLTSKGAETIPMVKEAAEISTDEESDGV-----VICPPDENTRGCEEVVSGSDHDS 432 W S G TI V+E A I +G V E GCEE SGS+ DS Sbjct: 172 WGKCSDGDHTIDSVEENATIEYASSKEGSACKEGVDSSCKEEGGGCEEEGSGSEEDS 228
>ZN297_CANFA (Q5TJE2) Zinc finger protein 297| Length = 640 Score = 28.5 bits (62), Expect = 7.4 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 268 RRRWDLTSKGAET---IPMVKEAAEISTDEESDGVVICPPDENTRGCEEVVSGS 420 ++ W +G + P+V + ++ DEE D V+ C DE+ EE+ GS Sbjct: 295 QKHWVYVKRGGNSPAPAPLVPQDPDLEEDEEEDLVLTCEDDED----EELGGGS 344
>MPP10_SCHPO (O13910) U3 small nucleolar ribonucleoprotein protein mpp10| Length = 598 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +1 Query: 277 WDLTSKGAETIPMVKEAAEIST-DEESDGV-VICPPDENTRGCEEVVSGSDHDS 432 +D+ + +T+ + +EA E +E DG+ ++ PDEN E+ +G DS Sbjct: 165 FDIDNFNKQTLALEEEAVEEGVLGDEDDGIDLLMDPDENMEDSEDESNGPQADS 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.127 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,051,343 Number of Sequences: 219361 Number of extensions: 743350 Number of successful extensions: 1929 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1929 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)